BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F12 (507 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 24 0.90 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 2.7 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 22 3.6 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 3.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 3.6 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 21 4.8 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 8.4 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 23.8 bits (49), Expect = 0.90 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 232 EVFLLHPIHPYQSYPVSMPAL-YSYPQLLGTEMFHPHYYNLHN 107 EV L+P P+ + + + YS +L M H H Y++H+ Sbjct: 53 EVLRLYPSVPFIARSLGEDIVTYSGHKLKAGSMVHLHIYDMHH 95 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = -3 Query: 433 PPVQSVAP--YTRHPSSNPPASRLSLYQSTVESPT 335 P V V P Y H + PP S Y SPT Sbjct: 17 PVVLDVIPPHYNIHHGATPPQSPNQQYTKDCSSPT 51 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.8 bits (44), Expect = 3.6 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = -1 Query: 216 IQFILINHIQFQCQLSILI 160 +QF + H+ QC +++ I Sbjct: 38 LQFFAVEHLLIQCYIAVSI 56 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 3.6 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +2 Query: 212 WMQQEYLSQPVQFSLWTLTRSFDCHSCIRLLQEEISMR*FVCWTLYS*LIKG 367 WM E P + S W ++ S + + +E + ++ + TL L+ G Sbjct: 379 WMSGESFKSPYKASCWAQFKAVLWRSILAVFKEPLLIKVRLLQTLIISLVIG 430 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 3.6 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +2 Query: 212 WMQQEYLSQPVQFSLWTLTRSFDCHSCIRLLQEEISMR*FVCWTLYS*LIKG 367 WM E P + S W ++ S + + +E + ++ + TL L+ G Sbjct: 379 WMSGESFKSPYKASCWAQFKAVLWRSILAVFKEPLLIKVRLLQTLIISLVIG 430 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 21.4 bits (43), Expect = 4.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -2 Query: 383 TGVATFPLSVNCRESNTRTISSKFLPVVAGYKS 285 T + F +NC ++ + S LP+ + Y+S Sbjct: 14 TNGSNFSKFINCHYTSGHLLGSSSLPLRSFYRS 46 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 20.6 bits (41), Expect = 8.4 Identities = 6/18 (33%), Positives = 9/18 (50%) Frame = +1 Query: 73 ESHIEWCNDIKSYAGCSN 126 E+H W N + + C N Sbjct: 314 ENHASWVNHLSNIEDCLN 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,884 Number of Sequences: 336 Number of extensions: 2820 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -