BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F09 (623 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32682-4|CAA83612.1| 218|Caenorhabditis elegans Hypothetical pr... 29 2.7 AL117195-17|CAB60767.1| 534|Caenorhabditis elegans Hypothetical... 29 3.6 AC024791-14|AAF60658.1| 767|Caenorhabditis elegans P300/cbp ass... 28 4.7 U41009-8|AAA82282.2| 500|Caenorhabditis elegans Hypothetical pr... 27 8.2 U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical pr... 27 8.2 >Z32682-4|CAA83612.1| 218|Caenorhabditis elegans Hypothetical protein M04D8.4 protein. Length = 218 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 175 RDCIVLNSMQSTKY*FIWISLQ*V*QASFIFWVDLNMYSLF*MHFLHSV-SGVN 17 ++C + S+Q IW+ L Q ++ FW+ LN SLF HF +V S +N Sbjct: 5 QECFHIISIQIEFLNNIWVRLMNYIQVNY-FWLGLNENSLFAEHFSTAVLSAIN 57 >AL117195-17|CAB60767.1| 534|Caenorhabditis elegans Hypothetical protein Y57A10A.24 protein. Length = 534 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 27 LTLCKKCIQNKLYIFRSTQNIKLACQT 107 L LCK C+Q FR T N+++ CQ+ Sbjct: 181 LVLCKDCVQGVCAKFR-TSNVEVCCQS 206 >AC024791-14|AAF60658.1| 767|Caenorhabditis elegans P300/cbp associated factor homologprotein 1 protein. Length = 767 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 150 MEFKTMQSRRKHEAYTDQFVWI 215 ++FKTMQ + K +AYT Q ++I Sbjct: 691 IDFKTMQEKLKRKAYTHQHLFI 712 >U41009-8|AAA82282.2| 500|Caenorhabditis elegans Hypothetical protein C06E7.4 protein. Length = 500 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 491 KSQLLSFSVFALDE*HHTFHKHTQLSHRSLMES 589 K ++S +++ HH H H QL H +++S Sbjct: 246 KRDIISPPMYSSTPHHHNHHNHQQLQHHQVIKS 278 >U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical protein C03F11.1 protein. Length = 471 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -2 Query: 556 MFVKCVMLFVKGKNTEA**LRFSTV*DISITYILNGY 446 MFV+C GKN ++ L +++ I+IT++LNGY Sbjct: 281 MFVQCERYGFSGKNPQSI-LYSNSLWFIAITFMLNGY 316 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,844,397 Number of Sequences: 27780 Number of extensions: 277094 Number of successful extensions: 459 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -