BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F08 (437 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0517 + 9054816-9055655 29 1.6 04_04_1630 - 34896021-34896143,34896329-34896403,34896500-348965... 27 5.0 02_05_1001 + 33423562-33424098 27 5.0 12_02_0918 - 24299620-24299748,24299890-24300037,24303105-243032... 27 6.6 01_05_0197 + 19143582-19143618,19143814-19144523 27 6.6 10_02_0002 - 4018145-4018545,4018563-4018605 27 8.7 05_05_0039 - 21782093-21782320,21782383-21782754,21783031-217834... 27 8.7 05_01_0425 - 3347604-3347708,3348394-3348466,3349917-3350581,335... 27 8.7 01_06_0630 - 30723903-30724496 27 8.7 >03_02_0517 + 9054816-9055655 Length = 279 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +3 Query: 159 ENLKHVCCLRTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTL 293 +++ H C+ W L S P+C LPA+ + + IW L Sbjct: 154 KHVYHQDCILPWLSLRNSCPVCRRELPAAAAPESEADAGLTIWRL 198 >04_04_1630 - 34896021-34896143,34896329-34896403,34896500-34896556, 34897176-34897352,34897426-34897492,34898043-34898101, 34898188-34898241,34898455-34898604,34898709-34898918, 34898980-34899039,34899399-34899527,34899616-34899720, 34899935-34900024,34900630-34900695,34901047-34901115, 34901348-34901467,34901572-34901634,34901681-34901817, 34902070-34902160,34902298-34902463,34902700-34904172, 34905666-34905940,34906322-34906819,34906996-34907145, 34907840-34907911,34908006-34908266,34908478-34908558, 34908745-34908996,34909323-34909382,34909602-34909853, 34910385-34910549,34910589-34910849,34911267-34912307, 34913398-34913457,34914055-34914165,34914448-34914534, 34915227-34915300,34915397-34915490,34915644-34915689, 34916397-34916521 Length = 2501 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 284 LDIDRAHANYRAITNLKRQFPQLRVFL 364 + +D ANYRA+ L + FP ++ F+ Sbjct: 2373 ITLDTPGANYRAVWALSKYFPNVKTFV 2399 >02_05_1001 + 33423562-33424098 Length = 178 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 303 CARSMSKFSLSETILYVSA--WMPADLYSRWVQNERA 199 CA S E + + S W PAD+ + WV ERA Sbjct: 80 CALVHSHGPYGENLFHGSGVGWAPADVVAAWVSRERA 116 >12_02_0918 - 24299620-24299748,24299890-24300037,24303105-24303280, 24305870-24305917,24306005-24306116,24306209-24306468 Length = 290 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 296 RAHANYRAITNLKRQFPQLRVFLTVGGDDDTEDPQK 403 RAH + + R+ RV VGG DD ED ++ Sbjct: 109 RAHPSLHVLVGWARRMIGFRVSTPVGGCDDEEDGRR 144 >01_05_0197 + 19143582-19143618,19143814-19144523 Length = 248 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 7/54 (12%) Frame = +2 Query: 125 VLCYYDSKSYIRES-------QARMLPTDLEPALSFCTHLLYKSAGIQADTYKM 265 + +YD KS IR+ + ++ D+E + F HL+ +S G+ D +K+ Sbjct: 132 ITSHYDGKSGIRKHILEMTHMENQLRSMDMEISDGFLVHLIMRSLGLNYDPFKI 185 >10_02_0002 - 4018145-4018545,4018563-4018605 Length = 147 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 293 DRAHANYRAITNLKRQFPQLRVFLTVGGDDDTEDPQK 403 DRA A+YR + + + G DDD DP++ Sbjct: 111 DRAVADYRNVARVWTRVVSFGTTRGFGSDDDPSDPER 147 >05_05_0039 - 21782093-21782320,21782383-21782754,21783031-21783496, 21784896-21784993,21785179-21785362,21785462-21785574, 21785942-21786127,21786191-21786364 Length = 606 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 186 RTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWTLIG 299 RTW+ +F + CC S I FH+ RIW+ +G Sbjct: 170 RTWTYIFGA---CC-----STTVFIPSFHNYRIWSFLG 199 >05_01_0425 - 3347604-3347708,3348394-3348466,3349917-3350581, 3350609-3351088,3351253-3351534 Length = 534 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 6/37 (16%) Frame = +3 Query: 42 RPWSPSPGYW------R*RLRLPTTQHHLVAKAKSSA 134 R WSPS G W R RLPTT+ H + A Sbjct: 433 RAWSPSVGDWLADRPRTLRFRLPTTKDHTTERISGLA 469 >01_06_0630 - 30723903-30724496 Length = 197 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 171 HVCCLRTWSLLFRSAPIC 224 HVCCL W S P+C Sbjct: 146 HVCCLDAWLRRNASCPVC 163 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,688,090 Number of Sequences: 37544 Number of extensions: 217803 Number of successful extensions: 594 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -