BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F07 (580 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98851-1|CAB11539.2| 327|Caenorhabditis elegans Hypothetical pr... 28 4.2 AF101318-7|AAC69345.1| 826|Caenorhabditis elegans Hypothetical ... 27 9.6 >Z98851-1|CAB11539.2| 327|Caenorhabditis elegans Hypothetical protein H12I19.1 protein. Length = 327 Score = 28.3 bits (60), Expect = 4.2 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%) Frame = -1 Query: 343 LLKMFYLEVLTFDKSYF*IYLY*LTISLFVNIQFY----FNL*FY*V*QINRRKYILKTP 176 + ++FYL ++ F +Y T IQ + FN FY + I YI+ Sbjct: 117 ITQIFYLLIIVLAFERFLLYFLKSTERTLQIIQTFIHRHFNS-FYAIFAIKDALYIISWL 175 Query: 175 VSRNNYKYYIVFKWWKLY 122 VS NY++++ F + +Y Sbjct: 176 VSSGNYQFWLEFSYMTVY 193 >AF101318-7|AAC69345.1| 826|Caenorhabditis elegans Hypothetical protein Y73C8C.3 protein. Length = 826 Score = 27.1 bits (57), Expect = 9.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 199 RKYILKTPVSRNNYKYYIVFKW 134 RK++ K P+ N +KY F W Sbjct: 220 RKFVEKFPICDNEFKYRTFFSW 241 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,736,957 Number of Sequences: 27780 Number of extensions: 182978 Number of successful extensions: 317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1205362812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -