BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F07 (580 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28800.1 68417.m04118 bHLH family protein contains Pfam profi... 31 0.73 At2g31820.1 68415.m03886 ankyrin repeat family protein contains ... 28 3.9 >At4g28800.1 68417.m04118 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 478 Score = 30.7 bits (66), Expect = 0.73 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 15 NVPSHPRLLNSFCQSSVVHPLHMPEPTTFQVIKYY 119 N P P +N + Q + H L P P FQV Y+ Sbjct: 432 NQPQFPAYMNPYSQFAGPHQLQQPPPPPFQVTLYH 466 >At2g31820.1 68415.m03886 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 662 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -2 Query: 99 K*LVRACGEDERQKIDKMNLKGE 31 K L+R CG++ ++ + K NL+GE Sbjct: 168 KELIRGCGDELKELLSKQNLEGE 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,746,421 Number of Sequences: 28952 Number of extensions: 160103 Number of successful extensions: 268 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -