BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E24 (584 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 25 0.62 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 3.3 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 4.4 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.7 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 24.6 bits (51), Expect = 0.62 Identities = 11/41 (26%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 189 DGRT-NVPLISIKQESDKNSDARFAAVEIKSFAEVEQTVKT 308 DG++ +VP+IS+K E++ + +++ + E +QT ++ Sbjct: 214 DGKSEDVPVISLKNENELPQQHKTNVMDVMQWWEQQQTPRS 254 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = +3 Query: 321 CGDKEHAFLAIKEIDDNYYVVYSAPFTPNGLTLIVLNAR 437 C D E F + + D +V PN TLI + + Sbjct: 381 CTDVEQKFFQVSKFDKRSKLVSILEKAPNERTLIFVETK 419 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 402 PNGLTLIVLNARTIPTQADLDKTVSGIPNLS 494 PN ++ + A + D D ++SG+P LS Sbjct: 281 PNNKLILGIPAYGRAWKMDEDSSISGVPPLS 311 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +3 Query: 333 EHAFLAIKEIDDNYYVVYSAPFTPNG 410 E FLA +E YY +Y NG Sbjct: 53 EQLFLAERERGLKYYPIYKLDVCGNG 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,262 Number of Sequences: 336 Number of extensions: 2818 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -