BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E24 (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 3.2 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 3.2 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 5.5 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 9.6 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 9.6 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 324 GDKEHAFLAIKEIDDNYYVVYSA 392 GD H F ++ DNYYV + A Sbjct: 172 GDAAHQFEHMQITADNYYVTWEA 194 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 127 NLVLVVTGLPLPR*AKSIAPATVGPTSR*FLLN 225 N +L + GLP PR A ++VG ++ FLLN Sbjct: 63 NEILNLLGLPGPRPAVRHLHSSVGKSAPQFLLN 95 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 5.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 469 VLSKSACVGIVLAFSTIKVSPFGVNGAEYTT 377 VL +A I A +T+K P GVN Y T Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTGVNATRYGT 165 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.6 bits (46), Expect = 9.6 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 286 SAKDFISTAANRASEFLSDSCLIEINGTLVLPSQVQWTSLTLV 158 +AKD A S LI++ G L++ ++ T LTLV Sbjct: 76 TAKDVTLYAIEEGSVAFPRVPLIKVAGPLIIVQLLETTLLTLV 118 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 22.6 bits (46), Expect = 9.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 139 VVTGLPLPR*AKSIAPATVGPTSR*FLLNKN 231 V+ L +P +AP+ V P F++N N Sbjct: 23 VLDPLRVPNHTTVVAPSAVSPHQSSFMINNN 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,542 Number of Sequences: 2352 Number of extensions: 11381 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -