BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E22 (324 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 2.1 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 3.7 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.8 bits (44), Expect = 2.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 49 RTDTRNNLANIFV 11 R DT+NNL N +V Sbjct: 50 RQDTKNNLLNAYV 62 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.0 bits (42), Expect = 3.7 Identities = 10/40 (25%), Positives = 15/40 (37%) Frame = +3 Query: 99 YIEQYEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPI 218 Y + E W N+ V R NS+ + + V I Sbjct: 264 YFHSLASRVESWVNTSVIRNYTLFNENSEAAARSFVPFSI 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,917 Number of Sequences: 438 Number of extensions: 1611 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7093251 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -