BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E20 (448 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 27 0.30 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 6.5 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 6.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 6.5 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 27.1 bits (57), Expect = 0.30 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 310 EGQPNVVEYAYSLWYRSGEDIVKVYFPIE 396 E QP V Y LW R G +V PIE Sbjct: 4 EAQPQQVSAPYQLWPRKGSVVVMQPQPIE 32 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.6 bits (46), Expect = 6.5 Identities = 11/43 (25%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 307 LEGQPNVVEYAYSLWYR-SGEDIVKVYFPIEFRLLFNEDPVLI 432 LEG PN+ Y + Y E+I ++ + + L P+++ Sbjct: 185 LEGHPNITGYQQCVTYHYFEEEIYQIIYNVLVMCLMYTFPLIV 227 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.6 bits (46), Expect = 6.5 Identities = 11/43 (25%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 307 LEGQPNVVEYAYSLWYR-SGEDIVKVYFPIEFRLLFNEDPVLI 432 LEG PN+ Y + Y E+I ++ + + L P+++ Sbjct: 185 LEGHPNITGYQQCVTYHYFEEEIYQIIYNVLVMCLMYTFPLIV 227 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 428 NTGSSLNNSRNSIG 387 NTG+S NN+ N +G Sbjct: 68 NTGNSGNNNNNGVG 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 386,336 Number of Sequences: 2352 Number of extensions: 6299 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -