BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E09 (594 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.8 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 7.8 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 275 RLDCDWFKILNPPNFDTSLTTSVGECWMNSSLGS 174 +L+C+W N ++ T + CW + +GS Sbjct: 15 QLECNWSSGPNATLQSSACTDDLSSCW-SEDMGS 47 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 330 SDKRNNLSWDIHYWI 374 +D N ++ IHYWI Sbjct: 2038 ADATFNTNFTIHYWI 2052 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.0 bits (42), Expect = 7.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 588 VSRHPDSSRRG*NRTGYPHPSIVV 517 VS HPDS + T P P + V Sbjct: 214 VSEHPDSPNSKKSATPSPPPQLEV 237 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,955 Number of Sequences: 336 Number of extensions: 3319 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -