BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E05 (267 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 27 1.8 SB_51723| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.6 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 165 IRIMTRMY*NSGDIIKIDYSLHKHHNRYYAF 73 +R Y I D+SLHK H +Y+AF Sbjct: 1104 LRFYADSYRRRASIKPCDHSLHKDHFQYFAF 1134 >SB_51723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 25.0 bits (52), Expect = 9.6 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 138 NSGDIIKIDYSLHKHHN 88 NSGD KIDYS HK N Sbjct: 394 NSGD--KIDYSQHKREN 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,737,929 Number of Sequences: 59808 Number of extensions: 127038 Number of successful extensions: 184 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 16,821,457 effective HSP length: 65 effective length of database: 12,933,937 effective search space used: 297480551 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -