Samia BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_E05
         (267 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37504| Best HMM Match : PIP5K (HMM E-Value=0)                       27   1.8  
SB_51723| Best HMM Match : No HMM Matches (HMM E-Value=.)              25   9.6  

>SB_37504| Best HMM Match : PIP5K (HMM E-Value=0)
          Length = 2119

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -1

Query: 165  IRIMTRMY*NSGDIIKIDYSLHKHHNRYYAF 73
            +R     Y     I   D+SLHK H +Y+AF
Sbjct: 1104 LRFYADSYRRRASIKPCDHSLHKDHFQYFAF 1134


>SB_51723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 445

 Score = 25.0 bits (52), Expect = 9.6
 Identities = 12/17 (70%), Positives = 12/17 (70%)
 Frame = -1

Query: 138 NSGDIIKIDYSLHKHHN 88
           NSGD  KIDYS HK  N
Sbjct: 394 NSGD--KIDYSQHKREN 408


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,737,929
Number of Sequences: 59808
Number of extensions: 127038
Number of successful extensions: 184
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 184
length of database: 16,821,457
effective HSP length: 65
effective length of database: 12,933,937
effective search space used: 297480551
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)