BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E05 (267 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 22 3.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 22 4.5 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.2 bits (45), Expect = 3.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 112 VDFDDITGILIHSCHYAYGR 171 V DI+ +++ CH YGR Sbjct: 142 VRVQDISLLIVDECHKNYGR 161 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 21.8 bits (44), Expect = 4.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 105 LHKHHNRYYAFLILADSAAGDPSLTPPGGVVAL 7 +H H N +Y L+L++SAA S P + L Sbjct: 208 VHNHSN-HYLDLVLSNSAAAACSSVYPASSLLL 239 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 260,544 Number of Sequences: 2352 Number of extensions: 3844 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 14857014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -