BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E05 (267 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC048120-1|AAH48120.3| 652|Homo sapiens chromosome 12 open read... 27 8.1 BC017959-1|AAH17959.1| 291|Homo sapiens chromosome 2 open readi... 27 8.1 AK026208-1|BAB15393.1| 291|Homo sapiens protein ( Homo sapiens ... 27 8.1 AC097717-3|AAY24163.1| 291|Homo sapiens unknown protein. 27 8.1 >BC048120-1|AAH48120.3| 652|Homo sapiens chromosome 12 open reading frame 40 protein. Length = 652 Score = 27.5 bits (58), Expect = 8.1 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = -1 Query: 216 RIKDS-LYSI*TSERLSSIRIMTRMY*NSGD-IIKIDYSLHKHHNRYYAFLI 67 +I+DS +I T E++++ + RM SGD I+K D +HK + +Y F + Sbjct: 509 QIEDSNRMTIKTKEKMNNFYV-ERMAKLSGDRIVKNDDKIHKQNENFYQFSV 559 >BC017959-1|AAH17959.1| 291|Homo sapiens chromosome 2 open reading frame 47 protein. Length = 291 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 20 PPGGVKLGSPAAESARIKKA*YLLWCLCRL 109 P G V+L +PA R+ A +C CRL Sbjct: 18 PCGAVRLRTPAVAEVRLPSATLCYFCRCRL 47 >AK026208-1|BAB15393.1| 291|Homo sapiens protein ( Homo sapiens cDNA: FLJ22555 fis, clone HSI01193. ). Length = 291 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 20 PPGGVKLGSPAAESARIKKA*YLLWCLCRL 109 P G V+L +PA R+ A +C CRL Sbjct: 18 PCGAVRLRTPAVAEVRLPSATLCYFCRCRL 47 >AC097717-3|AAY24163.1| 291|Homo sapiens unknown protein. Length = 291 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 20 PPGGVKLGSPAAESARIKKA*YLLWCLCRL 109 P G V+L +PA R+ A +C CRL Sbjct: 18 PCGAVRLRTPAVAEVRLPSATLCYFCRCRL 47 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,592,380 Number of Sequences: 237096 Number of extensions: 580018 Number of successful extensions: 886 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 76,859,062 effective HSP length: 66 effective length of database: 61,210,726 effective search space used: 1346635972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -