BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E02 (633 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.1 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 6.1 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.1 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 6.1 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = -2 Query: 206 FPGQRKHCRSLVPRN*CRYQMCSYACVFP-C--PTLAH 102 FP +K CRS+V Q C+ A F C PT+ H Sbjct: 532 FPVHKKGCRSIVSNYRGITQTCATAKTFELCIFPTILH 569 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 6.1 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 305 YRFGMILREV*-GYLPVLVPIDQNSRTRLRCEISFPG 198 +R M +R V YLP ++ + + +TRLR + PG Sbjct: 327 HRMPMWIRSVFLHYLPAMLLMKRPRKTRLRWMMEMPG 363 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 120 WKYTSIRTHLISTLI 164 W+Y ++RT +IST I Sbjct: 1512 WRYNNMRTGVISTAI 1526 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,716 Number of Sequences: 2352 Number of extensions: 13001 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -