BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_E02 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.5 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 7.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 210 YLTSQTCSTILVYW 251 Y+TS T S+IL++W Sbjct: 1411 YVTSSTSSSILLHW 1424 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 210 YLTSQTCSTILVYW 251 Y+TS T S+IL++W Sbjct: 1407 YVTSSTSSSILLHW 1420 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 71 FIAGESYAGKYVPALGMEIH 130 F+ G+ Y GKY+ E+H Sbjct: 147 FVPGDDYDGKYLVLPSGELH 166 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 562 KLCWIITESSLIVG 603 K+CW IT ++ VG Sbjct: 492 KICWTITTPAICVG 505 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 562 KLCWIITESSLIVG 603 K+CW IT ++ VG Sbjct: 545 KICWTITTPAICVG 558 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 305 YRFGMILREV*-GYLPVLVPIDQNSRTRLRCEISFP 201 +R ++R++ YLP ++ + + +TRLR + P Sbjct: 328 HRMPQLIRKIFLKYLPTILMMRRPKKTRLRWMMEIP 363 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 7.5 Identities = 6/29 (20%), Positives = 17/29 (58%) Frame = -1 Query: 381 WCVITRSIVMRFTHLFLASMLLLAAISFW 295 WC + RS+ + F+ + ++ +++ +W Sbjct: 118 WCDVWRSLDVLFSTASILNLCVISLDRYW 146 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 139 LMLVYFHAQR 110 ++LVYFH QR Sbjct: 202 MLLVYFHLQR 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,111 Number of Sequences: 438 Number of extensions: 3800 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -