BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D23 (448 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 1.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 2.3 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 4.0 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 4.0 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 4.0 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.0 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 20 9.3 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 1.7 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = +2 Query: 50 LLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGN 229 +L +N+ E P + E QP Q S + + T +S K P +GN Sbjct: 378 ILNAINAALKSDEIPPEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKPQTTKTPESGN 437 Query: 230 EN 235 E+ Sbjct: 438 ES 439 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 136 GQLQGAPASGCTNCQL 183 G LQG P SGC C+L Sbjct: 305 GLLQGDPLSGCL-CEL 319 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 322 ERTRSDPHKNSYPWV 366 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 322 ERTRSDPHKNSYPWV 366 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 322 ERTRSDPHKNSYPWV 366 E + S+P N YPW+ Sbjct: 158 ENSVSEPPANFYPWM 172 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 20.6 bits (41), Expect = 7.0 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -2 Query: 234 FSFPVIGTLTIAPEVPSELTVSAPAC 157 F+F V+G T + + V+ P C Sbjct: 643 FAFTVVGAATTYITIIYQFQVNKPTC 668 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -1 Query: 289 SQLHLVSEIYGAKGTEPVIFVSSYRYLDH 203 S + L++ A T P++ ++ Y+ LD+ Sbjct: 188 SLICLLAWFIAALFTSPMLVIAEYKQLDY 216 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,020 Number of Sequences: 336 Number of extensions: 2140 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -