BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D20 (400 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_30571| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_56284| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) 26 9.8 SB_39659| Best HMM Match : 7tm_1 (HMM E-Value=5.7e-27) 26 9.8 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 27.5 bits (58), Expect = 4.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 289 WYLNNHLMYFTEKQNFKRRFYF 224 ++ NN+ ++FT QN+ R YF Sbjct: 233 YHSNNYRLFFTHNQNYYRNSYF 254 >SB_30571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 26.6 bits (56), Expect = 7.4 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 330 VCFHYYVEHHNP 365 +C HYY +HH+P Sbjct: 66 LCLHYYSQHHHP 77 >SB_56284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 336 NKLYCEVVSYCKVVLFGT*II 274 NK+Y +V+ C VVLFG I+ Sbjct: 169 NKIYTLIVNVCIVVLFGITIV 189 >SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) Length = 3404 Score = 26.2 bits (55), Expect = 9.8 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +2 Query: 47 LSFYIKTKLSQFHLNIHSKYTIS*KNNTLHISLVKKTIVIL*KYSLTVLHISGSCQ 214 LS IK LS+F LNI S +NTL + K +++++ L + CQ Sbjct: 2666 LSLVIKVDLSRFGLNITSPEIRLTDSNTLVLLSTKTSVMLVLDIDLVAKTHTKVCQ 2721 >SB_39659| Best HMM Match : 7tm_1 (HMM E-Value=5.7e-27) Length = 334 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 336 NKLYCEVVSYCKVVLFGT*II 274 NK+Y +V+ C VVLFG I+ Sbjct: 169 NKIYMFIVNVCIVVLFGITIV 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,986,974 Number of Sequences: 59808 Number of extensions: 153264 Number of successful extensions: 408 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -