BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D20 (400 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48009-5|CAA88086.1| 329|Caenorhabditis elegans Hypothetical pr... 29 1.2 U28736-2|AAA68307.1| 620|Caenorhabditis elegans Hypothetical pr... 27 3.7 >Z48009-5|CAA88086.1| 329|Caenorhabditis elegans Hypothetical protein AH6.7 protein. Length = 329 Score = 29.1 bits (62), Expect = 1.2 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 250 VFL*STLNDYLSTK*YYFTVTNYFTVKFVFTTTLNIIIHRVV*FTTN 390 VFL T+ + + + YYF V +T+ F+ + ++I+R+ TN Sbjct: 256 VFLLGTIREIIGYEQYYFWVVWVYTIPFIAASFPILLIYRIRYSNTN 302 >U28736-2|AAA68307.1| 620|Caenorhabditis elegans Hypothetical protein F26A10.2 protein. Length = 620 Score = 27.5 bits (58), Expect = 3.7 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 292 IWYLNNHLMYFTEKQNFKRRFYFADHLTGSTYVQH 188 +WYL H + + + FK +F F + S QH Sbjct: 60 VWYLKQHAVKHSNDRPFKCKFCFKTYKFRSNLYQH 94 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,126,294 Number of Sequences: 27780 Number of extensions: 130444 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 619699724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -