BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D16 (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 24 3.3 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 5.7 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 5.7 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 10.0 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 552 GRSSGTSCVAT*ACYRFAGGYPTSGSASRSPW 457 G S GTS Y+ YPT +PW Sbjct: 39 GHSIGTSLGVLRTFYQLGARYPTLTHTCNTPW 70 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 9 ALKKLTTQVLKNNNIDYFVGCTALRASSTWWSNVP 113 A KK+ +LK I +FV C+ + + ++ +P Sbjct: 254 AFKKIYKTILKLGLIPWFVECSLIAVCARFFLQLP 288 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 489 GNHPQICNMLKLPHKKYRYFDPKTNGFDLQGALEDI 596 GN+ + + ++ + RYFD +T D++ L D+ Sbjct: 324 GNNGTVKTLGQMETVEIRYFDAETQTSDVEKDLRDL 359 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 374 LILNDLAVFTKGQFG 330 LILN L V+T+G+ G Sbjct: 486 LILNRLVVYTEGEHG 500 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,768 Number of Sequences: 2352 Number of extensions: 14550 Number of successful extensions: 94 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -