BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0001_D15
(591 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 24 1.1
AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 3.4
>U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein.
Length = 425
Score = 23.8 bits (49), Expect = 1.1
Identities = 10/31 (32%), Positives = 16/31 (51%)
Frame = +3
Query: 387 MQERITTTKAGSITSVQAVYVPADDLTDPAP 479
+Q R +T+ A + Q +P+D T P P
Sbjct: 52 LQVRPSTSAAADVDGWQVTPLPSDGTTSPEP 82
>AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription
factor protein.
Length = 441
Score = 22.2 bits (45), Expect = 3.4
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = +3
Query: 102 YHEMKVGGVITD 137
YH+ +VGGVI D
Sbjct: 402 YHQNEVGGVIDD 413
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,427
Number of Sequences: 336
Number of extensions: 3539
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14830622
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -