BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D14 (406 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_6620| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 267 FYVFSHVYIITFFVSYIHIILDSYFYT 347 FY++ ++YI + YI+I +Y YT Sbjct: 9 FYIYIYIYIYIYIYIYIYIYTYTYTYT 35 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 249 IIIH*LFYVFSHVYIITFFVSYIHIILDSYFYT 347 I I+ Y++ ++YI T+ +Y + +Y YT Sbjct: 13 IYIYIYIYIYIYIYIYTYTYTYTYTYTYTYTYT 45 >SB_6620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 26.6 bits (56), Expect = 7.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 291 IITFFVSYIHIILDSYFYTL 350 ++ F SYIH +L+ Y Y+L Sbjct: 898 LVVGFCSYIHAVLNGYLYSL 917 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 26.6 bits (56), Expect = 7.7 Identities = 17/65 (26%), Positives = 24/65 (36%) Frame = -2 Query: 249 FSFSQSRGLGHCSDGWTSTYDCVSHSLANFLQFLEGIPRRRRNGPHSEDASDNQQNNFSE 70 +S S LG + WTS YD V + I P N++ NF + Sbjct: 1992 YSKSNRNDLGSNASLWTSKYDMVQRIAKMMCDIMPTI----SEDPPEIQFGQNEETNFEQ 2047 Query: 69 FMFNI 55 M N+ Sbjct: 2048 LMVNM 2052 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,756,508 Number of Sequences: 59808 Number of extensions: 186995 Number of successful extensions: 590 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -