BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D10 (350 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9G1.03c |rpl3001|rpl30-1, rpl30|60S ribosomal protein L30|Sc... 44 7e-06 SPAC1250.05 |rpl3002|rpl30-2, rpl30|60S ribosomal protein L30|Sc... 41 6e-05 SPCC794.07 |||dihydrolipoamide S-acetyltransferase E2 |Schizosac... 25 3.4 SPBC28E12.02 ||SPBC9B6.13|RNA-binding protein|Schizosaccharomyce... 24 6.0 SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schi... 24 6.0 >SPAC9G1.03c |rpl3001|rpl30-1, rpl30|60S ribosomal protein L30|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 44.0 bits (99), Expect = 7e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = +1 Query: 91 GNAPPLRKSEIEYYALP*PKQGVHHYEWKTIIELGYCLRKILQ 219 GN PPLRKSE+EYYA+ K VHHY T I+LG K+ + Sbjct: 52 GNCPPLRKSELEYYAML-SKANVHHYA-GTNIDLGTACGKLFR 92 Score = 41.5 bits (93), Expect = 4e-05 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = +2 Query: 194 GTACGKYYRVCTLAITDPGDSDII 265 GTACGK +RV LAITD GDSDI+ Sbjct: 84 GTACGKLFRVGVLAITDAGDSDIL 107 >SPAC1250.05 |rpl3002|rpl30-2, rpl30|60S ribosomal protein L30|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 40.7 bits (91), Expect = 6e-05 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = +1 Query: 94 NAPPLRKSEIEYYALP*PKQGVHHYEWKTIIELGYCLRKILQ 219 NAPPLRKSE+EYYA+ + VHHY I+LG K+ + Sbjct: 61 NAPPLRKSELEYYAML-SRCSVHHYSGNN-IDLGTACGKLFR 100 Score = 38.7 bits (86), Expect = 3e-04 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +2 Query: 194 GTACGKYYRVCTLAITDPGDSDII 265 GTACGK +RV LA+ D GDSDI+ Sbjct: 92 GTACGKLFRVGVLAVIDAGDSDIL 115 >SPCC794.07 |||dihydrolipoamide S-acetyltransferase E2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 483 Score = 25.0 bits (52), Expect = 3.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 102 SSEEVGDRILCSPLAK 149 S EE GDR+ SPLA+ Sbjct: 178 SGEERGDRVFASPLAR 193 >SPBC28E12.02 ||SPBC9B6.13|RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 663 Score = 24.2 bits (50), Expect = 6.0 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 51 VASGNVAKLVIIARECASSEEVGDRILCSPLAKTGCPP 164 V+S ++ +V + +G+++ SPL K PP Sbjct: 415 VSSSELSSIVSSTGSIVETNGIGEKMSFSPLKKLSIPP 452 >SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 766 Score = 24.2 bits (50), Expect = 6.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 175 KTIIELGYCLRKILQSMYSSN 237 K ++E+ CL +LQ Y+SN Sbjct: 720 KVLVEVCICLDDVLQRRYASN 740 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,139,136 Number of Sequences: 5004 Number of extensions: 20077 Number of successful extensions: 58 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 106195544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -