BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D09 (501 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061349-1|AAL28897.1| 433|Drosophila melanogaster LD28038p pro... 192 2e-49 AE014134-2713|AAF53532.1| 433|Drosophila melanogaster CG5809-PA... 192 2e-49 >AY061349-1|AAL28897.1| 433|Drosophila melanogaster LD28038p protein. Length = 433 Score = 192 bits (468), Expect = 2e-49 Identities = 82/124 (66%), Positives = 101/124 (81%) Frame = +3 Query: 3 NDYISILKRLGDKYKSKMWGWIWAEAAAQPTLEEALELGGFGYPAMAVVNAKKLKFSTLR 182 N ++ L+ LG+K+K K WGW WAE Q LEE+LE+GGFGYPAMAVVN KK+KFS L+ Sbjct: 310 NKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLK 369 Query: 183 GSFSETGINEFLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDGELPLEEDIDLSDVDLE 362 GSFS+ GINEFLR +S+GRG TAPV+GA+ P I + +PWDG DG+LP EEDIDLSD+DL+ Sbjct: 370 GSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEEDIDLSDIDLD 429 Query: 363 KDEL 374 KDEL Sbjct: 430 KDEL 433 >AE014134-2713|AAF53532.1| 433|Drosophila melanogaster CG5809-PA protein. Length = 433 Score = 192 bits (468), Expect = 2e-49 Identities = 82/124 (66%), Positives = 101/124 (81%) Frame = +3 Query: 3 NDYISILKRLGDKYKSKMWGWIWAEAAAQPTLEEALELGGFGYPAMAVVNAKKLKFSTLR 182 N ++ L+ LG+K+K K WGW WAE Q LEE+LE+GGFGYPAMAVVN KK+KFS L+ Sbjct: 310 NKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLK 369 Query: 183 GSFSETGINEFLRGLSFGRGQTAPVKGAEMPKITTTEPWDGNDGELPLEEDIDLSDVDLE 362 GSFS+ GINEFLR +S+GRG TAPV+GA+ P I + +PWDG DG+LP EEDIDLSD+DL+ Sbjct: 370 GSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEEDIDLSDIDLD 429 Query: 363 KDEL 374 KDEL Sbjct: 430 KDEL 433 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,232,194 Number of Sequences: 53049 Number of extensions: 292852 Number of successful extensions: 1110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1110 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1784022528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -