BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D06 (363 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_47086| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 >SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 27.9 bits (59), Expect = 2.6 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 127 FGVKKRCYDCPLETHFCTILSTSMQNNSRQQFKYC 23 F V+ +C+ +C S M+ N R+ KYC Sbjct: 366 FDVRPQCHRWASHDQYCVYASYFMKRNCRKTCKYC 400 >SB_47086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 26.2 bits (55), Expect = 8.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 71 YCAKMSLQWTIVASFLYAE 127 YC KM + WTI L+A+ Sbjct: 70 YCHKMDVSWTIAVKSLFAK 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,744,919 Number of Sequences: 59808 Number of extensions: 185618 Number of successful extensions: 430 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -