BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D05 (285 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY278562-1|AAP35064.1| 963|Homo sapiens G-protein coupled recep... 30 1.2 AY255620-1|AAO85132.1| 279|Homo sapiens G protein-coupled recep... 30 1.2 AL137846-14|CAI10884.1| 963|Homo sapiens G protein-coupled rece... 30 1.2 AB065601-1|BAC05829.1| 984|Homo sapiens seven transmembrane hel... 30 1.2 BX538133-1|CAD98034.1| 1016|Homo sapiens hypothetical protein pr... 28 6.3 BX538106-1|CAD98019.1| 1209|Homo sapiens hypothetical protein pr... 28 6.3 BX538040-1|CAD97981.1| 1053|Homo sapiens hypothetical protein pr... 28 6.3 BX537923-1|CAD97904.1| 1129|Homo sapiens hypothetical protein pr... 28 6.3 BC113713-1|AAI13714.2| 420|Homo sapiens neuropeptide FF recepto... 28 6.3 BC101636-1|AAI01637.1| 420|Homo sapiens neuropeptide FF recepto... 28 6.3 AF330053-1|AAK94197.1| 420|Homo sapiens neuropeptide NPFF recep... 28 6.3 AF268899-1|AAG41398.1| 420|Homo sapiens neuropeptide FF recepto... 28 6.3 AF257210-1|AAF87078.1| 420|Homo sapiens G-protein coupled recep... 28 6.3 AF236083-1|AAK58513.1| 408|Homo sapiens G-protein-coupled recep... 28 6.3 AF119815-1|AAD22047.1| 522|Homo sapiens G-protein-coupled recep... 28 6.3 AB095939-1|BAC23115.1| 2797|Homo sapiens KIAA2019 protein protein. 28 6.3 >AY278562-1|AAP35064.1| 963|Homo sapiens G-protein coupled receptor GPR144 protein. Length = 963 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 134 TLAISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGM 15 T+A+ +FLVA ++ ++ L LW++ AV++ P PGM Sbjct: 725 TVAMHFLFLVAFSWMLVEGLLLWRKV---VAVSMHPGPGM 761 >AY255620-1|AAO85132.1| 279|Homo sapiens G protein-coupled receptor PGR24 protein. Length = 279 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 134 TLAISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGM 15 T+A+ +FLVA ++ ++ L LW++ AV++ P PGM Sbjct: 107 TVAMHFLFLVAFSWMLVEGLLLWRKV---VAVSMHPGPGM 143 >AL137846-14|CAI10884.1| 963|Homo sapiens G protein-coupled receptor 144 protein. Length = 963 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 134 TLAISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGM 15 T+A+ +FLVA ++ ++ L LW++ AV++ P PGM Sbjct: 725 TVAMHFLFLVAFSWMLVEGLLLWRKV---VAVSMHPGPGM 761 >AB065601-1|BAC05829.1| 984|Homo sapiens seven transmembrane helix receptor protein. Length = 984 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -2 Query: 134 TLAISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGM 15 T+A+ +FLVA ++ ++ L LW++ AV++ P PGM Sbjct: 149 TVAMHFLFLVAFSWMLVEGLLLWRKV---VAVSMHPGPGM 185 >BX538133-1|CAD98034.1| 1016|Homo sapiens hypothetical protein protein. Length = 1016 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 158 PPTVLKLGTLAI-SGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVS 6 P V + +A+ G A VMS LS +R P T P+PG CVS Sbjct: 89 PKFVFSVPQMAVPEGDLHAAVGAPVMSPLSPGERVQCPLPSTQLPSPGTCVS 140 >BX538106-1|CAD98019.1| 1209|Homo sapiens hypothetical protein protein. Length = 1209 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 158 PPTVLKLGTLAI-SGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVS 6 P V + +A+ G A VMS LS +R P T P+PG CVS Sbjct: 282 PKFVFSVPQMAVPEGDLHAAVGAPVMSPLSPGERVQCPLPSTQLPSPGTCVS 333 >BX538040-1|CAD97981.1| 1053|Homo sapiens hypothetical protein protein. Length = 1053 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 158 PPTVLKLGTLAI-SGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVS 6 P V + +A+ G A VMS LS +R P T P+PG CVS Sbjct: 126 PKFVFSVPQMAVPEGDLHAAVGAPVMSPLSPGERVQCPLPSTQLPSPGTCVS 177 >BX537923-1|CAD97904.1| 1129|Homo sapiens hypothetical protein protein. Length = 1129 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 158 PPTVLKLGTLAI-SGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVS 6 P V + +A+ G A VMS LS +R P T P+PG CVS Sbjct: 202 PKFVFSVPQMAVPEGDLHAAVGAPVMSPLSPGERVQCPLPSTQLPSPGTCVS 253 >BC113713-1|AAI13714.2| 420|Homo sapiens neuropeptide FF receptor 2 protein. Length = 420 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 273 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 312 >BC101636-1|AAI01637.1| 420|Homo sapiens neuropeptide FF receptor 2 protein. Length = 420 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 273 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 312 >AF330053-1|AAK94197.1| 420|Homo sapiens neuropeptide NPFF receptor protein. Length = 420 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 273 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 312 >AF268899-1|AAG41398.1| 420|Homo sapiens neuropeptide FF receptor 2 protein. Length = 420 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 273 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 312 >AF257210-1|AAF87078.1| 420|Homo sapiens G-protein coupled receptor HLWAR77 protein. Length = 420 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 273 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 312 >AF236083-1|AAK58513.1| 408|Homo sapiens G-protein-coupled receptor 74 protein. Length = 408 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 276 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 315 >AF119815-1|AAD22047.1| 522|Homo sapiens G-protein-coupled receptor protein. Length = 522 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 125 ISGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVSV 3 I + +VA F ++SWL LW L LSPN +++ Sbjct: 375 IKMLLIVALLF-ILSWLPLWTLMMLSDYADLSPNELQIINI 414 >AB095939-1|BAC23115.1| 2797|Homo sapiens KIAA2019 protein protein. Length = 2797 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 158 PPTVLKLGTLAI-SGIFLVAKAFAVMSWLSLWKRFTLPAAVTLSPNPGMCVS 6 P V + +A+ G A VMS LS +R P T P+PG CVS Sbjct: 1870 PKFVFSVPQMAVPEGDLHAAVGAPVMSPLSPGERVQCPLPSTQLPSPGTCVS 1921 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.317 0.134 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,285,828 Number of Sequences: 237096 Number of extensions: 950162 Number of successful extensions: 1637 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1637 length of database: 76,859,062 effective HSP length: 71 effective length of database: 60,025,246 effective search space used: 1380580658 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -