BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D03 (556 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 3.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.2 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 9.5 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 9.5 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 3.1 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 411 ERLQDYCRHQQRSRSAYLPGIRSRFGGGFVQGGSRI 518 + LQ+ R Q +A P + S+F GF + S + Sbjct: 86 KHLQNLQRQQAAMSAATDPSVVSKFRAGFSECASEV 121 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 117 VVTIGSLFYSSRATFQRFRRKSCASN 40 V +GSLF SSR F + +K S+ Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSH 166 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 117 VVTIGSLFYSSRATFQRFRRKSCASN 40 V +GSLF SSR F + +K S+ Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSH 166 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 117 VVTIGSLFYSSRATFQRFRRKSCASN 40 V +GSLF SSR F + +K S+ Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSH 166 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 117 VVTIGSLFYSSRATFQRFRRKSCASN 40 V +GSLF SSR F + +K S+ Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSH 166 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 391 IQHLAGMKDSKTIVAINKDPE 453 I A +KD K A +KDPE Sbjct: 555 IYAFATLKDHKLAEASDKDPE 575 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 110 PSGAFSTAPEPPS 72 PSG ST PPS Sbjct: 124 PSGVISTNTSPPS 136 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 20.6 bits (41), Expect = 9.5 Identities = 5/14 (35%), Positives = 7/14 (50%) Frame = +2 Query: 476 ITVWWRICSRRFQN 517 + +WW C R N Sbjct: 57 LKLWWEFCQRNGHN 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.138 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,859 Number of Sequences: 336 Number of extensions: 2582 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -