BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D02 (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 84 4e-17 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 39 0.002 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 31 0.40 SB_57396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.70 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 1.2 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 29 2.1 SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 28 2.8 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 2.8 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 28 3.7 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 28 3.7 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 28 3.7 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 3.7 SB_23935| Best HMM Match : bZIP_Maf (HMM E-Value=0.76) 28 3.7 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 28 3.7 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 3.7 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 28 3.7 SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 27 4.9 SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) 27 6.5 SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) 27 6.5 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_31229| Best HMM Match : TP2 (HMM E-Value=1.7) 27 8.6 SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) 27 8.6 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 27 8.6 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 27 8.6 SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 84.2 bits (199), Expect = 4e-17 Identities = 36/47 (76%), Positives = 45/47 (95%) Frame = -1 Query: 426 SGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 286 +GDAA+V ++PSKP+CVE+F EFPPLGRFAVRDM+QTVAVGVIK+V+ Sbjct: 255 TGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMKQTVAVGVIKSVD 301 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = -1 Query: 414 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 298 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 31.1 bits (67), Expect = 0.40 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 414 AIVNLVPSKPLCVESFQEFPPLGRFAVRD 328 AI L +C+E F +F +GRF +RD Sbjct: 517 AIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_57396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 30.3 bits (65), Expect = 0.70 Identities = 18/73 (24%), Positives = 36/73 (49%) Frame = -3 Query: 370 LPGIPTPRSFRRA*HEADGRRRCNKGCELQGSRWWQSHQSCRKSHQGQEVASTVNSSVLY 191 L G+P+ F++ H++ RRR + E+ GSR + SH+ Q +V+ + Sbjct: 166 LRGLPSDNVFKKGMHKSLRRRREDVPDEVDGSRGFDVDNEEMVSHENQVFNKSVDLNPGE 225 Query: 190 TTAILHSPKGVQK 152 +LH + +++ Sbjct: 226 FANLLHRNRNIKE 238 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A+ GV + GR P G WR PG +WR Sbjct: 19 YAKAVPSGVKLVGRNPRYGEWRHKRPGYEWR 49 >SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 503 Score = 28.3 bits (60), Expect = 2.8 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 256 QSCRKSHQGQEVASTVNSSVLYTTAILHSPKGVQKERRATN 134 +S +KS + A T+NS+ +YT + P+ V + TN Sbjct: 238 KSAKKSKKSDATAPTINSTGIYTQLVDLLPRNVVLDDEVTN 278 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 28.3 bits (60), Expect = 2.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 302 TPTATVCLMSRTAKRPRGGNSWKDSTHRGLEG 397 TP+ VCL+SR + PR W R + G Sbjct: 282 TPSLYVCLLSRAHRDPRLSTGWSPYEKREVRG 313 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 ++++P++P CV SF EF + +RD+ Q Sbjct: 381 MSVMPAQPQCVASFPEFCAVSVSYIRDLLQ 410 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 385 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 414 >SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) Length = 549 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 389 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 418 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 1044 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1073 >SB_23935| Best HMM Match : bZIP_Maf (HMM E-Value=0.76) Length = 715 Score = 27.9 bits (59), Expect = 3.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 232 GQEVASTVNSSVLYTTAILHSPKGVQKERRATN 134 G+ V +T+N + L+++ I HSP Q RA+N Sbjct: 97 GESVHTTLNDTPLHSSVIDHSPMYPQDTIRASN 129 >SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 532 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 561 >SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) Length = 1285 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 1111 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1140 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 184 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 87 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 116 >SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 27.9 bits (59), Expect = 3.7 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -2 Query: 416 PPLSTWFPPSPCVWSPSRNSHPSVVSPCVT*GRRSPSV**RL*TSRKQVVAKSPKLPKKP 237 PP +PPSP + PS + +P R P + R S + + P+ P P Sbjct: 293 PPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSP 352 Query: 236 PR 231 PR Sbjct: 353 PR 354 >SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A++ GV + R+P G WR +PG +WR Sbjct: 657 YAKKVPSGVKLVERSPRYGEWRHKKPGYEWR 687 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A++ GV + R+P G WR +PG +WR Sbjct: 659 YAKKVPSGVKLVERSPRYGEWRHKKPGYEWR 689 >SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) Length = 1344 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +1 Query: 286 VHSLYYTDG---DRLPHVTHGETTEGWEFLEGLHTQGLG 393 VH YT+G D++ VT GET W + G+ +G Sbjct: 734 VHIWSYTNGIDMDQVGLVTSGETVHIWSYTNGIDKDQVG 772 >SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) Length = 314 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 324 SCHARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 S +A+ GV + R P G WR +PG +WR Sbjct: 71 SIYAKAVPSGVKLVERNPRYGEWRHKKPGYEWR 103 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 26.6 bits (56), Expect = 8.6 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -2 Query: 416 PPLSTWFPPSPCVWSPSRNSHP 351 PP ++PP+P + P++ S+P Sbjct: 180 PPTQPFYPPTPSSYPPTQPSYP 201 >SB_31229| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 676 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 259 HQSCRKSHQGQEVASTVNSSVLYTTAILHSPKGVQ 155 H ++ G+E+ S ++ SVL+ AIL P+ +Q Sbjct: 537 HTFQSETQLGKEITSEISRSVLWIVAILLVPQALQ 571 >SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) Length = 748 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A+ GV + R P G WR PG +WR Sbjct: 640 YAKEISNGVKLVERNPRYGEWRHKRPGYEWR 670 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A+ GV + R P G WR PG +WR Sbjct: 640 YAKEISNGVKLVERNPRYGEWRHKRPGYEWR 670 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A+ GV + R P G WR PG +WR Sbjct: 551 YAKAEPSGVKLVERNPRYGEWRHKRPGYEWR 581 >SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) Length = 231 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 408 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 319 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFFAVSVSYIRDILQ 32 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 26.6 bits (56), Expect = 8.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 330 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 416 +A+ GV I R P G WR +PG +WR Sbjct: 447 YAKAVPSGVKIVERNPRYGEWRHKKPGYEWR 477 >SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1900 Score = 26.6 bits (56), Expect = 8.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 195 KTELLTVLATSCPWWLFRQL 254 + ELL+++ S PWWL +++ Sbjct: 1765 QVELLSLIEESLPWWLLKRV 1784 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,046,384 Number of Sequences: 59808 Number of extensions: 282394 Number of successful extensions: 1022 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -