BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D02 (426 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 27 0.21 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 27 0.21 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 27 0.21 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 25 1.1 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 25 1.1 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 25 1.5 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 25 1.5 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 25 1.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 25 1.5 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 1.5 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 2.6 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 2.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 3.4 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 3.4 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 4.5 DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 23 4.5 AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 23 6.0 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 23 6.0 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 6.0 AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodi... 22 7.9 AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodi... 22 7.9 AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodi... 22 7.9 AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodi... 22 7.9 AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodi... 22 7.9 AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodi... 22 7.9 AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodi... 22 7.9 AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodi... 22 7.9 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 7.9 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 27.5 bits (58), Expect = 0.21 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 274 RWWQSHQSCRKSHQGQEVASTVNSSVLYTTAI 179 RW ++HQSC +HQ + + LY AI Sbjct: 44 RWSKAHQSCAGAHQSPIAIHSHRAVPLYMPAI 75 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 27.5 bits (58), Expect = 0.21 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 425 LVMPPLSTWFPPSPCVWSPSRNSHPSVVS 339 ++MP ++ W P + P+ NS+P++V+ Sbjct: 73 VIMPGVTHWHSPKFHAYFPTANSYPAIVA 101 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 27.5 bits (58), Expect = 0.21 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 425 LVMPPLSTWFPPSPCVWSPSRNSHPSVVS 339 ++MP ++ W P + P+ NS+P++V+ Sbjct: 104 VIMPGVTHWHSPKFHAYFPTANSYPAIVA 132 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 25.0 bits (52), Expect = 1.1 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 307 RCNKGCELQGSRWWQSHQSCRKSHQGQEVASTVN 206 RC ++ GS+ WQ +SC + E ++V+ Sbjct: 66 RCASYIQVSGSKIWQMERSCMCCQESGEREASVS 99 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 25.0 bits (52), Expect = 1.1 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 307 RCNKGCELQGSRWWQSHQSCRKSHQGQEVASTVN 206 RC ++ GS+ WQ +SC + E ++V+ Sbjct: 66 RCASYIQVSGSKIWQMERSCMCCQESGEREASVS 99 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Score = 23.0 bits (47), Expect = 4.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T + PTAT T P +W D Sbjct: 179 PPPTTTTTTVWTDPTATT-----TTPAPTTTTTWSD 209 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRP 349 PPP + T + PT T+ TA P Sbjct: 246 PPPTTTTTTVWTDPTTTITTDYTTAYPP 273 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Score = 23.0 bits (47), Expect = 4.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T + PTAT T P +W D Sbjct: 179 PPPTTTTTTVWTDPTATT-----TTPAPTTTTTWSD 209 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 211 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 241 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Score = 23.0 bits (47), Expect = 4.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T + PTAT T P +W D Sbjct: 179 PPPTTTTTTVWTDPTATT-----TTHAPTTTTTWSD 209 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 2.6 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 211 PPPPTTTTTVWIDPTATT-----TTHVPTTTTTWSD 241 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 2.6 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHVPTTTTTWSD 242 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 3.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 266 PPPASLKFTAFITPTATVCLMSRTAKRPRGGNSWKD 373 PPP + T +I PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHVPPTTTTWSD 242 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 3.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 12 FYEFTL*FAVITKHLRCMYNLI 77 F EF F +ITK L+ MY +I Sbjct: 1128 FTEFMRGFHIITKKLKEMYQMI 1149 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 4.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 424 W*CRHCQPGSLQAPVCGVLPGIPTPRS 344 W RH GSL VC +L PTP S Sbjct: 12 WRRRHLLTGSLLLLVCLLLAIDPTPVS 38 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.0 bits (47), Expect = 4.5 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 379 CGVLPGIPTPRSFRRA*HEADGRRRCNKGCELQGSRWWQSHQSCRKSHQGQEV 221 CG G T + R+ +++ RR CN GC +G C S+ Q + Sbjct: 70 CGPACGDRTCTNQRK--NDSACRRSCNPGCFCRGGYVRNKSNRCVPSYMCQSM 120 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 136 NSFLFYIFYMAYTVTLFLIYIRLYI 62 +S + + +AY V FLI I +YI Sbjct: 11 SSTISITYLLAYLVISFLIVINMYI 35 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 136 NSFLFYIFYMAYTVTLFLIYIRLYI 62 +S + + +AY V FLI I +YI Sbjct: 11 SSTISITYLLAYLVISFLIVINMYI 35 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 275 ASLKFTAFITPTATVCLMSRTA 340 AS + I+P ATVC MS+ A Sbjct: 608 ASNSGSTVISPNATVCPMSKGA 629 >AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 17 YLLAYLVISFLIVINMYI 34 >AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 17 YLLAYLVISFLIVINMYI 34 >AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 19 YLLAYLVISFLIVINMYI 36 >AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 18 YLLAYLVISFLIVINMYI 35 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 115 FYMAYTVTLFLIYIRLYI 62 + +AY V FLI I +YI Sbjct: 1843 YLLAYLVISFLIVINMYI 1860 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 472,925 Number of Sequences: 2352 Number of extensions: 9715 Number of successful extensions: 90 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -