BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_D01 (488 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC037209-1|AAH37209.1| 792|Homo sapiens zinc finger protein 606... 30 3.7 AF455357-1|AAL58442.1| 792|Homo sapiens zinc finger protein 328... 30 3.7 AB058755-1|BAB47481.1| 948|Homo sapiens KIAA1852 protein protein. 30 3.7 >BC037209-1|AAH37209.1| 792|Homo sapiens zinc finger protein 606 protein. Length = 792 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 130 VFLEKTSKGIKQYNIRPIDPWFISSLDVLADEDMRLLFHFN 252 +F E+ S G+K DPWF S L+VL +D ++H N Sbjct: 150 IFEEEQSHGMKLERYIWDDPWF-SRLEVLGCKDQLEMYHMN 189 >AF455357-1|AAL58442.1| 792|Homo sapiens zinc finger protein 328 protein. Length = 792 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 130 VFLEKTSKGIKQYNIRPIDPWFISSLDVLADEDMRLLFHFN 252 +F E+ S G+K DPWF S L+VL +D ++H N Sbjct: 150 IFEEEQSHGMKLERYIWDDPWF-SRLEVLGCKDQLEMYHMN 189 >AB058755-1|BAB47481.1| 948|Homo sapiens KIAA1852 protein protein. Length = 948 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 130 VFLEKTSKGIKQYNIRPIDPWFISSLDVLADEDMRLLFHFN 252 +F E+ S G+K DPWF S L+VL +D ++H N Sbjct: 306 IFEEEQSHGMKLERYIWDDPWF-SRLEVLGCKDQLEMYHMN 345 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,115,067 Number of Sequences: 237096 Number of extensions: 1482213 Number of successful extensions: 3527 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3527 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4366354454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -