BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C23 (472 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70756-7|CAA94794.2| 199|Caenorhabditis elegans Hypothetical pr... 29 1.7 Z70756-8|CAA94795.2| 212|Caenorhabditis elegans Hypothetical pr... 28 2.9 Z22177-1|CAA80151.1| 578|Caenorhabditis elegans Hypothetical pr... 28 3.9 U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequen... 27 6.8 AC006674-12|AAO38617.1| 357|Caenorhabditis elegans Hypothetical... 27 6.8 U39993-1|AAA81086.1| 594|Caenorhabditis elegans Hypothetical pr... 27 9.0 AF003141-14|AAM48549.1| 362|Caenorhabditis elegans Hypothetical... 27 9.0 AF003141-13|AAK21490.1| 549|Caenorhabditis elegans Hypothetical... 27 9.0 >Z70756-7|CAA94794.2| 199|Caenorhabditis elegans Hypothetical protein T06E4.8 protein. Length = 199 Score = 29.1 bits (62), Expect = 1.7 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 140 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 256 V A P P F+ P+ P PI GPAF P P Sbjct: 110 VFAAPRPVFASPALAPVAPMAPILRGPAFAYAPSPVLAP 148 >Z70756-8|CAA94795.2| 212|Caenorhabditis elegans Hypothetical protein T06E4.9 protein. Length = 212 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 140 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 256 V A P P F+ P+ P P+ GPAF P P Sbjct: 123 VFAAPRPVFAAPALAPVAPMAPVLRGPAFAYAPSPVLAP 161 >Z22177-1|CAA80151.1| 578|Caenorhabditis elegans Hypothetical protein ZK512.2 protein. Length = 578 Score = 27.9 bits (59), Expect = 3.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 344 IL*YFPNFNLVMHLYKYFFYCLG 412 IL +FP+ N V + YK F CLG Sbjct: 260 ILIFFPSCNSVRYFYKIFERCLG 282 >U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequence x-hybridizingprotein 1 protein. Length = 589 Score = 27.1 bits (57), Expect = 6.8 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 Query: 98 DNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 223 D SG P G DP +QPS GP G + P P+ Sbjct: 291 DPSGAPPSGGPPGPF----DPSGAQPSGGPPGPFNPSGAPPS 328 >AC006674-12|AAO38617.1| 357|Caenorhabditis elegans Hypothetical protein K12H6.6b protein. Length = 357 Score = 27.1 bits (57), Expect = 6.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 128 YCRPMEHHYCPPRELCLRQPWP 63 +C P+++ Y P + L PWP Sbjct: 282 HCSPLQYPYSNPYSILLDAPWP 303 >U39993-1|AAA81086.1| 594|Caenorhabditis elegans Hypothetical protein F47E1.3 protein. Length = 594 Score = 26.6 bits (56), Expect = 9.0 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 149 NPDPFFSQP--SNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPL 277 +P PF + P SN S P F + PP R +PL Sbjct: 90 SPPPFMTSPATSNNSVSVARKTSAPPGFAQYEPDTAPPSRSTSPL 134 >AF003141-14|AAM48549.1| 362|Caenorhabditis elegans Hypothetical protein W02D3.11b protein. Length = 362 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 152 PDPFFSQPSNGPSGNYEPIS 211 P PF S P P G Y+P S Sbjct: 219 PPPFASAPQTAPRGAYDPYS 238 >AF003141-13|AAK21490.1| 549|Caenorhabditis elegans Hypothetical protein W02D3.11a protein. Length = 549 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 152 PDPFFSQPSNGPSGNYEPIS 211 P PF S P P G Y+P S Sbjct: 219 PPPFASAPQTAPRGAYDPYS 238 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,757,685 Number of Sequences: 27780 Number of extensions: 195318 Number of successful extensions: 554 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 850313440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -