BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C21 (455 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 2.4 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 2.4 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 7.2 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 7.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.2 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 2.4 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 1 AELAVGIAGYVKHKDLETSIVKHLNET---IAQYPTNKDV 111 A L + HK+++ IV+ +NE I + PT +D+ Sbjct: 319 AALGFALMVLAGHKEVQDKIVEEMNEVLGDIKKKPTYQDL 358 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 2.4 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 1 AELAVGIAGYVKHKDLETSIVKHLNET---IAQYPTNKDV 111 A L + HK+++ IV+ +NE I + PT +D+ Sbjct: 319 AALGFALMVLAGHKEVQDKIVEEMNEVLGDIKKKPTYQDL 358 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 7.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 284 PLVWKPGVSLVQATRTPSLISCPV 213 PLV +PG S AT + S P+ Sbjct: 98 PLVQEPGSSTTSATSGAVMASPPM 121 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 20.6 bits (41), Expect = 7.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 384 EYHTQELN*SDAEPDSSEHYSDILEV 307 E H ++ + PD S + SD++EV Sbjct: 3 ENHLEQTLENAGMPDESINISDVIEV 28 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.6 bits (41), Expect = 7.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 51 LEVLVLHVTSDTDS 10 L+ L +HVT DTD+ Sbjct: 590 LKNLEIHVTKDTDT 603 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,790 Number of Sequences: 336 Number of extensions: 1982 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -