BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C20 (227 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 62 3e-12 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 62 3e-12 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 62 3e-12 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 0.43 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 0.43 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 1.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 1.7 AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase... 22 2.3 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 22 3.1 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 22 3.1 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 22 3.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 21 4.0 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 21 5.3 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 20 9.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 20 9.3 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 20 9.3 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 20 9.3 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 61.7 bits (143), Expect = 3e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 121 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVK 225 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVK Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVK 35 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 61.7 bits (143), Expect = 3e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 121 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVK 225 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVK Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVK 35 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 61.7 bits (143), Expect = 3e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 121 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVK 225 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVK Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVK 35 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.6 bits (51), Expect = 0.43 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 174 TASQKVFGERDWIGEIRHFVRXCGPLWVDTC 82 T Q VF WIG +H R CG ++ C Sbjct: 1812 TTCQTVF----WIGLRKHHCRSCGQIFCAEC 1838 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.6 bits (51), Expect = 0.43 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 174 TASQKVFGERDWIGEIRHFVRXCGPLWVDTC 82 T Q VF WIG +H R CG ++ C Sbjct: 1813 TTCQTVF----WIGLRKHHCRSCGQIFCAEC 1839 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 1.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -1 Query: 71 GLRHTRNGKTTKNEPPIFN 15 G RHTR G + PP + Sbjct: 838 GSRHTRQGSEASSPPPFLD 856 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 1.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 160 SLWRTRLDRRDSTFCSXMWSSLGG 89 S WR++LD ++ + LGG Sbjct: 1493 SHWRSKLDESEAATLGALMDDLGG 1516 >AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase alternate isoform protein. Length = 257 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -1 Query: 98 FGWILADKEGLRHTRNGKTTKNE 30 F W + D G HT G T E Sbjct: 79 FHWGIGDGSGCEHTLEGSTYSME 101 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 21.8 bits (44), Expect = 3.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 103 SSLGGYLRTRKDFGTHGMEKPRKTNPR 23 +++GG TR F H +E P + R Sbjct: 291 ATIGGDFWTRGGFDKHNLENPWRHGTR 317 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 21.8 bits (44), Expect = 3.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 103 SSLGGYLRTRKDFGTHGMEKPRKTNPR 23 +++GG TR F H +E P + R Sbjct: 291 ATIGGDFWTRGGFDKHNLENPWRHGTR 317 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 21.8 bits (44), Expect = 3.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 171 RYLRRRLQDSRSAHRARQ 224 R LRRR +RSA R RQ Sbjct: 1048 RLLRRREVRNRSAQRRRQ 1065 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 43 VFPFRVCRSPSLSASIHPKRTTXSNKMSNLADPVA 147 + P V SPS + + P +TT ++ + L P + Sbjct: 936 IVPNPVQASPSPATAPAPAKTTSTDSTNGLETPTS 970 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 21.0 bits (42), Expect = 5.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 148 TRLDRRDSTFCSXMWSSLG 92 TRL+ R C+ W S G Sbjct: 774 TRLEERSRIKCTMYWPSRG 792 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 20.2 bits (40), Expect = 9.3 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = -3 Query: 144 DWIGEIRHFVRXCGPLWVDTCGQG 73 DWIG H G +W G G Sbjct: 375 DWIGRCLHANVPRGQIWNTHHGMG 398 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 20.2 bits (40), Expect = 9.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 64 RSPSLSASIHPKRTTXSNK 120 RS S S+H +RT NK Sbjct: 241 RSSFRSLSMHKRRTRKQNK 259 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 20.2 bits (40), Expect = 9.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 106 WSSLGGYLRTRKDFG 62 W+ +G YL T FG Sbjct: 182 WNEIGSYLPTSPLFG 196 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 20.2 bits (40), Expect = 9.3 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 19 KIGGSFFV 42 K+GGSFFV Sbjct: 166 KVGGSFFV 173 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,747 Number of Sequences: 2352 Number of extensions: 3696 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 52 effective length of database: 441,675 effective search space used: 10158525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -