BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C17 (390 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 0.81 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 4.3 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.7 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 20 10.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 20 10.0 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 20 10.0 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.4 bits (48), Expect = 0.81 Identities = 21/83 (25%), Positives = 31/83 (37%), Gaps = 1/83 (1%) Frame = +1 Query: 97 PTGAPPSACFDMIPGHAADVQTVPAPYTITT-AVSSVKAGHSIDVVISGKTPEDKMAGIL 273 P AP SA + P P T ++ + +SV + S + I K G++ Sbjct: 11 PPPAPQSAATPISSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKRAAYDCEGVI 70 Query: 274 LEARQGDKIVGTWTVSPDDTFSQ 342 G W SPD+ F Q Sbjct: 71 RHH-------GQWNYSPDNHFEQ 86 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 4.3 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = +2 Query: 77 WRLPALTPPEHRLARAST*SQGTLLMFRQYQRLT 178 W L + PP ++++ T SQ +++ LT Sbjct: 324 WSLTSSPPPPYQISAQPTPSQSPNQIYQPVTNLT 357 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 307 CRRSCHPDELPGGCR 263 C R C D +P CR Sbjct: 44 CARKCVKDSVPMTCR 58 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 19.8 bits (39), Expect = 10.0 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 340 ARRYHRGLRSKCRR 299 +RR+ + L+ CRR Sbjct: 260 SRRHRKNLKDPCRR 273 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 19.8 bits (39), Expect = 10.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 333 GIIGAYGP 310 G IGAYGP Sbjct: 198 GAIGAYGP 205 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 19.8 bits (39), Expect = 10.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 168 SALHHHYSCQLGK 206 S +HHH + LGK Sbjct: 132 SHVHHHQTSLLGK 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,672 Number of Sequences: 336 Number of extensions: 2165 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8225022 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -