BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C17 (390 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|... 27 0.77 SPBP23A10.07 |rpa2||DNA-directed RNA polymerase I complex subuni... 26 2.4 SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharo... 25 5.5 SPAC1006.08 |etd1||ethanol-hypersensitive mutant protein |Schizo... 24 7.2 SPAC8F11.04 |||U3 snoRNP-associated protein Cic1/Utp30 family |S... 24 7.2 SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein... 24 9.5 SPAC13G6.11c |erg12||mevalonate kinase Erg12 |Schizosaccharomyce... 24 9.5 >SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 27.5 bits (58), Expect = 0.77 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 97 PTGAPPSACFDMIPGHAADVQTVPAPYT--ITTAVSSVKAGHSIDVVISGKTP 249 P S F+ IP +V+++ Y+ + T +S +KA + ++ GK P Sbjct: 257 PANYITSTAFESIPESGHNVRSLEITYSGSLLTNISLIKADDLVGALVDGKLP 309 >SPBP23A10.07 |rpa2||DNA-directed RNA polymerase I complex subunit Rpa2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1227 Score = 25.8 bits (54), Expect = 2.4 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -1 Query: 267 AGHFVFGCFAADNHVNGMTSFYRAD---SCSDGVRRWYCLNISSV 142 AG FG D + TSF D +CSD + W C + S+ Sbjct: 1104 AGGIRFGEMERDAVIGHGTSFLMQDRLMNCSDYAQSWVCRDCGSI 1148 >SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 574 Score = 24.6 bits (51), Expect = 5.5 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 163 VPAPYTITTAVSSVKAGHSIDVVISG 240 VP+P+ +TA SS + +S+D+ SG Sbjct: 184 VPSPFGASTASSSSRRVYSVDLRDSG 209 >SPAC1006.08 |etd1||ethanol-hypersensitive mutant protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 391 Score = 24.2 bits (50), Expect = 7.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 282 SFQEDAGHFVFGCFAADNHVNGMTSF 205 +F+E+ GH G HV GM S+ Sbjct: 27 TFEENRGHSFEGVTLQRRHVKGMKSY 52 >SPAC8F11.04 |||U3 snoRNP-associated protein Cic1/Utp30 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 373 Score = 24.2 bits (50), Expect = 7.2 Identities = 14/61 (22%), Positives = 23/61 (37%) Frame = -1 Query: 354 TVEGLREGIIGAYGPSADDLVTLTSFQEDAGHFVFGCFAADNHVNGMTSFYRADSCSDGV 175 T E L+ ++ AYG + + +SF GH +V + F DG Sbjct: 174 TAEQLKREVVSAYGATYFNSAPCSSFMIKCGHVSNTSTELAENVESILQFVSKHIVPDGA 233 Query: 174 R 172 + Sbjct: 234 K 234 >SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 23.8 bits (49), Expect = 9.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 336 EGIIGAYGPSADDLVTLTSFQEDAGH 259 EGI G + + T TS Q ++GH Sbjct: 117 EGISSTTGSTFQSMTTFTSSQTNSGH 142 >SPAC13G6.11c |erg12||mevalonate kinase Erg12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 404 Score = 23.8 bits (49), Expect = 9.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 174 RRWYCLNISSVPWDHV 127 RRW N+ S+PW HV Sbjct: 59 RRW---NLQSLPWQHV 71 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,745,125 Number of Sequences: 5004 Number of extensions: 35170 Number of successful extensions: 71 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 128029482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -