BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C17 (390 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52550.1 68418.m06525 expressed protein 30 0.48 At2g02120.1 68415.m00148 plant defensin-fusion protein, putative... 29 0.84 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 29 1.5 At5g06580.1 68418.m00743 FAD linked oxidase family protein simil... 27 3.4 At4g04650.1 68417.m00680 hypothetical protein 26 7.8 At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family pr... 26 7.8 At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family pro... 26 7.8 >At5g52550.1 68418.m06525 expressed protein Length = 360 Score = 30.3 bits (65), Expect = 0.48 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -1 Query: 195 DSCSDGVRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYVSEHH 40 + C D R PWD+ + SGG++ H RC+ Y V +++ Sbjct: 250 EDCDDSYRNTLNQETGFKPWDYT-TKINLFSGGINRFFPHQRCSSYAVHDNN 300 >At2g02120.1 68415.m00148 plant defensin-fusion protein, putative (PDF2.1) plant defensin protein family member, personal communication, Bart Thomma (Bart.Thomma@agr.kuleuven.ac.be); contains a gamma-thionin family signature (PDOC00725) Length = 77 Score = 29.5 bits (63), Expect = 0.84 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -3 Query: 313 SKCRRSCHPDELPGG-CRPFCLRVFC 239 + C CH + PGG CR F R FC Sbjct: 48 TNCENVCHNEGFPGGDCRGFRRRCFC 73 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 28.7 bits (61), Expect = 1.5 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 103 GAPPSACF-DMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTP 249 G PS C D I A + +P + T + GH++ I+GKTP Sbjct: 447 GWSPSKCQEDKIEPPQASPGSTSSPNPLPTDEQQSRGGHAVSPAIAGKTP 496 >At5g06580.1 68418.m00743 FAD linked oxidase family protein similar to SP|Q12627 from Kluyveromyces lactis and SP|P32891 from Saccharomyces cerevisiae; contains Pfam FAD linked oxidases, C-terminal domain PF02913, Pfam FAD binding domain PF01565 Length = 567 Score = 27.5 bits (58), Expect = 3.4 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 350 LRGCEKV-SSGLTVQVPTILSP*RASRRMPAILSSGVLPL 234 LR C ++ S+ + T+LSP + RR+P SS + PL Sbjct: 17 LRPCRQLHSTPKSTGDVTVLSPVKGRRRLPTCWSSSLFPL 56 >At4g04650.1 68417.m00680 hypothetical protein Length = 332 Score = 26.2 bits (55), Expect = 7.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 144 VPWDHVEARARRCSGGVSAGKRHHRCNCYYVSEHHLFYKFQ 22 V W+ + R R + G+S CN + S HLF++ Q Sbjct: 149 VAWNRLHTRDRLQNWGLSIPAECLLCNAHDDSRAHLFFECQ 189 >At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family protein / F-box family protein contains similarity to F-box protein FBL2 GI:6010699 from [Rattus norvegicus]; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain Length = 930 Score = 26.2 bits (55), Expect = 7.8 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -1 Query: 192 SCSDGVRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYV 52 S + + W CL SS W ++ R + ++A N +Y+ Sbjct: 69 SLASTCKTWRCLGASSCLWTSLDLRPHKFDASMAASLASRCVNLHYL 115 >At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family protein contains Pfam domain, PF05183: RNA dependent RNA polymerase Length = 927 Score = 26.2 bits (55), Expect = 7.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 159 DSTSALHHHYSCQLGKSWSFH*RGYQRQNT 248 +S S H+Y C + S+ +GY +NT Sbjct: 207 ESDSGKTHYYQCHVAPDGSYRLKGYFLENT 236 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,736,786 Number of Sequences: 28952 Number of extensions: 208176 Number of successful extensions: 557 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 557595584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -