BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C16 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 23 1.9 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 4.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.9 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 58 YILFIVNFAKVNADCGIVSKDDWDG 132 ++LF + A V+A C V K +DG Sbjct: 4 FVLFAILIAIVHASCASVPKVVYDG 28 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -2 Query: 110 TIPQSALTFAKFTINKI*TKQRSIFILQTHILR 12 T+ + A T + T NK+ + +++FIL I+R Sbjct: 181 TMNKIAETLDEDTKNKLIEESKTVFILNNEIIR 213 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 61 YKQNKEAYSSYKLIYY 14 Y N Y++YK +YY Sbjct: 104 YNYNNNNYNNYKKLYY 119 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 490 DSDYNVVGHRQLMATDSPGRKLYNIIRRWP 579 DSDY + + + S RKL NI+ P Sbjct: 201 DSDYTDKSNEKKIPKSSGWRKLRNIVHWTP 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,001 Number of Sequences: 438 Number of extensions: 4884 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -