BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C12 (522 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC24B10.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 28 0.73 SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharom... 28 0.97 SPBC4C3.12 |sep1||fork head transcription factor Sep1|Schizosacc... 26 3.9 SPAC56F8.16 |esc1||transcription factor Esc1 |Schizosaccharomyce... 25 5.2 SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 25 9.0 SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 25 9.0 SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pom... 25 9.0 SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|... 25 9.0 >SPCC24B10.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 156 Score = 28.3 bits (60), Expect = 0.73 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 2 GKIVFLLLVALCVGVQSRYLIVSEPVYYIQHYEEPELLTSSRV 130 GK+ LL+ A + +Q + + P+ ++H E ELL ++RV Sbjct: 3 GKVSSLLVFASFLIIQGAFATLVAPIGDLEHLSEIELLYTNRV 45 >SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 27.9 bits (59), Expect = 0.97 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +2 Query: 125 RVRRDAHGALTLNSDGTSGAGVKVPFAGNDKNIVSAI-GSLDLTNRQKLGAATAGVALDN 301 R+ RD + N DGTSGA + F G K + + S D+++ K AA VALD Sbjct: 442 RIVRDIADVIEDNMDGTSGALYAIFFHGFAKGMKDTLEKSKDISS--KTWAAGLKVALDT 499 Query: 302 V 304 + Sbjct: 500 L 500 Score = 25.0 bits (52), Expect = 6.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 281 AGVALDNVNGHGVSLTDTHIPG 346 A A+DN+ G SL H+PG Sbjct: 178 AKAAIDNLVSIGASLAHVHVPG 199 >SPBC4C3.12 |sep1||fork head transcription factor Sep1|Schizosaccharomyces pombe|chr 2|||Manual Length = 663 Score = 25.8 bits (54), Expect = 3.9 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = -1 Query: 288 TPAVAAPSFCLLVKSKEPIALTIFLSLPAKG-TLTPAPEVPSELSVRAPCASLRTLELVN 112 TP + APS S ++ + ++ P + T +P+P + S S +P SLR L Sbjct: 299 TPGIDAPSDLEAKFSDLGVSSVVSVTSPLQSCTNSPSPPLSSPASSASPSESLRNESLGI 358 Query: 111 SSGSS 97 S S Sbjct: 359 KSAKS 363 >SPAC56F8.16 |esc1||transcription factor Esc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 413 Score = 25.4 bits (53), Expect = 5.2 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = -1 Query: 309 PFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAKGTLTPAPEVPSE 163 P T S++ V++ S + T+ ++ PA + TP P PS+ Sbjct: 155 PSTTDSSSTDVSSSDSVSTSASSSNASNTVSVTSPASSSATPLPNQPSQ 203 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 24.6 bits (51), Expect = 9.0 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 312 WPFTLSSATPAVAAPSFCLLVKSKEPI-ALTIFLSLPAKGTLTPAPEVPSELS 157 +PF S P PS+ LV P LT+ + G L+ A +PS S Sbjct: 271 YPFQQPSYNPNALVPSYTTLVSQLPPSPCLTV-----SSGPLSTASSIPSNCS 318 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 213 SLPAKGTLTPAPEVPSELSVRAPCASLRTLELVNS 109 S+P G P VP + S +A SLRT ++ S Sbjct: 210 SIPKVGETYNDPSVPKDFSRKAIHESLRTKNILQS 244 >SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 963 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 213 SLPAKGTLTPAPEVPSE 163 SLPA GT TP+P V + Sbjct: 725 SLPAAGTATPSPVVSQQ 741 >SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 24.6 bits (51), Expect = 9.0 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 403 VVIVVEEIHFAGSCHLVSEPG 341 +V + +IHF+G+C+ V+ G Sbjct: 397 IVSIPHQIHFSGTCYSVAAGG 417 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,153,918 Number of Sequences: 5004 Number of extensions: 43472 Number of successful extensions: 135 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -