BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C11 (447 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 3e-22 SB_8966| Best HMM Match : SAP (HMM E-Value=1.6e-08) 30 0.76 SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) 30 1.0 SB_51401| Best HMM Match : PseudoU_synth_1 (HMM E-Value=2e-28) 29 2.3 SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) 29 2.3 SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) 28 4.0 SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05) 28 4.0 SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_46976| Best HMM Match : PAN (HMM E-Value=6.9e-05) 27 5.3 SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) 27 5.3 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 27 7.1 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_57915| Best HMM Match : Dynein_heavy (HMM E-Value=1.8) 27 7.1 SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 101 bits (242), Expect = 3e-22 Identities = 43/59 (72%), Positives = 52/59 (88%) Frame = +1 Query: 211 VYLFQYDSTHGRFKGTVEAVDGHLVVNGKKIAVFSERDPHAIPWGQAGAEYVVESTGVF 387 VY+F+YDSTHGRFKGTVEA DG LV+NGK ++VF+ +DP IPWG+ GA+YVVESTGVF Sbjct: 817 VYMFKYDSTHGRFKGTVEAKDGKLVINGKPVSVFACKDPTQIPWGETGADYVVESTGVF 875 >SB_8966| Best HMM Match : SAP (HMM E-Value=1.6e-08) Length = 696 Score = 30.3 bits (65), Expect = 0.76 Identities = 17/69 (24%), Positives = 34/69 (49%) Frame = -1 Query: 258 GTLETTVSRIILEKVDHVVKTNERIIDSNNIGTLINRSTEHQATDATKTVNSDFRHDYGK 79 G+L T +I L K + + ++ ++ +E Q + ++NS+FRHD Sbjct: 126 GSLNKTDLKIELGKRKLLTSGLKPVLVDRLKSYILEHESESQRGNDISSLNSNFRHDQVS 185 Query: 78 SIFSQRSHS 52 S+ + ++HS Sbjct: 186 SVSADQNHS 194 >SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) Length = 993 Score = 29.9 bits (64), Expect = 1.0 Identities = 17/69 (24%), Positives = 33/69 (47%) Frame = -1 Query: 258 GTLETTVSRIILEKVDHVVKTNERIIDSNNIGTLINRSTEHQATDATKTVNSDFRHDYGK 79 G+L T +I L K + + ++ ++ +E Q + +NS+FRHD Sbjct: 88 GSLNKTDLKIELGKRKLLTSGLKSVLVDRLKSYILEHESESQRGNDISRLNSNFRHDQVS 147 Query: 78 SIFSQRSHS 52 S+ + ++HS Sbjct: 148 SVSADQNHS 156 >SB_51401| Best HMM Match : PseudoU_synth_1 (HMM E-Value=2e-28) Length = 503 Score = 28.7 bits (61), Expect = 2.3 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 103 GINGFGRIGRLVLRASIDKGADVVAINDPFIGLD 204 G++ FG++ L +R ++DKG V+ + +G D Sbjct: 137 GVSAFGQVISLNVRTNLDKGPGVILRQESSVGRD 170 >SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) Length = 829 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 336 NSMGIPLREHSYLLSVYDEV-SIYGLNGTLETTVSRIILEKVDHVVKTNERIIDSNNIGT 160 N+M E Y + YD V +I G + L+TT LEKV + R+I +N Sbjct: 662 NAMDFEYHEDHYEVVNYDLVINIPGQDSVLDTTNFSDFLEKVLSFAEAEGRVIRNNEFAG 721 Query: 159 LIN 151 + N Sbjct: 722 MSN 724 >SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) Length = 972 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +1 Query: 55 VTSLRKYTLTIIMSKIGINGFGRIGRLVLRASIDKGADVVAINDPFIGLD 204 + S K T++ + G R ++ L ++ AD++ ++DP I LD Sbjct: 213 LASFPKRDSTVVGDRCGTLSESRRAKINLARAVYSDADILLLDDPLISLD 262 >SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05) Length = 670 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 156 INRSTEHQATDATKTVNSDFRHDYGKSIFSQRSHS 52 + +E Q + +NS+FRHD S+ + ++HS Sbjct: 10 LEHESESQRGNNISRLNSNFRHDQVSSVSADQNHS 44 >SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1560 Score = 27.5 bits (58), Expect = 5.3 Identities = 21/58 (36%), Positives = 24/58 (41%) Frame = +2 Query: 263 RP*MDTSS*TERR*LCSLRGIPMLFHGVRLVLNTLLNQPVCSTNTDKASAHLVGGAKK 436 RP +D T R SL I FH L LN LLN S + KA + KK Sbjct: 685 RPNLDKEQVTAREVQASLIPILQSFHERSLFLNALLNPATPSLSVLKAGMKVTFDDKK 742 >SB_46976| Best HMM Match : PAN (HMM E-Value=6.9e-05) Length = 699 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 202 DYMVYLFQYDSTHGRFKGTVEAVDGHLVVNGKKIAV 309 DY+ + ++ + R+ G +GH V++GK I+V Sbjct: 659 DYLSHYYRTSALDNRYSGVSFKENGHKVMDGKLISV 694 >SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1266 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 55 VTSLRKYTLTIIMSK-IGINGFGRIGRLVLRASIDKGADVVAINDPFIGLDYMV 213 V L K L++I + + ++G G+ RL L ++ GAD+ ++DP +D V Sbjct: 536 VKRLPKGDLSMIGQRGVSLSG-GQRSRLSLARAVYSGADIFLLDDPLSAVDTQV 588 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 175 QQHRHPYQSKHGAPGDRC 122 QQ+ HPY H + GD C Sbjct: 74 QQYGHPYPQSHSSRGDGC 91 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 216 VDHVVKTNERIIDSNNIGTLINRSTEHQATDATKTVNSDFRHDYGK 79 +D V K N R+I N +I++ T + D T + R +YG+ Sbjct: 517 LDTVTK-NSRVIQLQNYLPMISKETHQELADRTGLHVVELREEYGR 561 >SB_57915| Best HMM Match : Dynein_heavy (HMM E-Value=1.8) Length = 185 Score = 27.1 bits (57), Expect = 7.1 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = -1 Query: 327 GIPLREHSYLLSVYDEVSIYGLNGTLETTVS-RIILEKVDHVVKTNERIIDSNNIGTLIN 151 G+PL H L+ + + I+GL+ + T + R + D ++ T R S G Sbjct: 12 GLPLTPHPELMLTFYILQIFGLHENADITKNQRETQQLFDGILSTLPRQTSSG--GKSSQ 69 Query: 150 RSTEHQATDATKTVNSDF 97 E A D + SDF Sbjct: 70 EVIEELAADILSKIPSDF 87 >SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 27.1 bits (57), Expect = 7.1 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 183 IDSNNIGTLINRSTEHQATDATKTVNSDFRHDYGKSIFSQRSHST 49 +DS N GT R+ Q D T +SD+ +D SQR+ +T Sbjct: 222 VDSQNCGTPSKRTK--QTKDETSRPDSDYDYDTIDVSLSQRARAT 264 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,562,700 Number of Sequences: 59808 Number of extensions: 304705 Number of successful extensions: 879 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -