BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C10 (538 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.3 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 23 2.3 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 23 2.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 409 PWNWVPSVFNCG*FLRIILGHFSTQ 335 P +VP NC + R +LG Q Sbjct: 1105 PGQYVPDPHNCNAYYRCVLGELRKQ 1129 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.6 bits (46), Expect = 2.3 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 23 LHWLPLAALLVYIVCYAIGLSTVPYVTIGEMFP-TNVKLYASCIAHIYTGISMFAVQKL 196 LH + + VY +C IGL+T+ GE+ + Y S YT +S++++ ++ Sbjct: 18 LHNIYTSMKPVYAICKLIGLNTLRIGRKGELKQHKSDYFYFSFYITSYTLLSVYSLFRI 76 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.6 bits (46), Expect = 2.3 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 23 LHWLPLAALLVYIVCYAIGLSTVPYVTIGEMFP-TNVKLYASCIAHIYTGISMFAVQKL 196 LH + + VY +C IGL+T+ GE+ + Y S YT +S++++ ++ Sbjct: 18 LHNIYTSMKPVYAICKLIGLNTLRIGRKGELKQHKSDYFYFSFYITSYTLLSVYSLFRI 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,300 Number of Sequences: 336 Number of extensions: 2777 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -