BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C09 (416 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 0.60 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 0.79 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 1.4 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 2.4 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 3.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 3.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 3.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.4 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 21 7.4 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 21 7.4 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 0.60 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPI 121 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.79 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N + Y Y+NY + + YK L +I+ +EQ P+ Sbjct: 87 NNYNYSNYNNYNNNNNYNNYKKLY-YNINYIEQIPV 121 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 183 NVHKYKQYHNYQT*S*RHKYKHLVSLHISSVEQWPL 290 N +KY Y+NY + + YK+ +I ++EQ P+ Sbjct: 87 NNYKYSNYNNYNNYNKKLYYKN----YIINIEQIPV 118 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 2.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 317 HIKKRKSRNPLNGNPFAKGVVLKTLIKKPKKP 412 H+K ++ L AK V K KP KP Sbjct: 222 HVKSIRAVTKLPDTSMAKSFVRKVHATKPPKP 253 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 186 HCVFKPVVSRENPRLRRFISQIND 115 H V K +SRE LRR + Q+ + Sbjct: 107 HAVHKEQLSREQRFLRRRLEQLTN 130 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 157 SANHRLKDAMYTNTS 201 S HRL++ +YTN S Sbjct: 203 SEQHRLQNRLYTNDS 217 Score = 20.2 bits (40), Expect = 9.7 Identities = 5/9 (55%), Positives = 9/9 (100%) Frame = -1 Query: 65 IYKWIRITY 39 +++WIR+TY Sbjct: 58 LWRWIRLTY 66 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 157 SANHRLKDAMYTNTS 201 S HRL++ +YTN S Sbjct: 241 SEQHRLQNRLYTNDS 255 Score = 20.2 bits (40), Expect = 9.7 Identities = 5/9 (55%), Positives = 9/9 (100%) Frame = -1 Query: 65 IYKWIRITY 39 +++WIR+TY Sbjct: 96 LWRWIRLTY 104 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 305 KTGPHIKKRKSRNPLNGN 358 KT P+ RK +P+NG+ Sbjct: 581 KTSPNSAVRKCMSPINGS 598 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.6 bits (41), Expect = 7.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 129 SQINDSFVKIIMSLFQI*LNKNLQ 58 +QIN F I+ S ++ +KN+Q Sbjct: 954 AQINPDFAFIVNSNLRLTFSKNVQ 977 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 20.6 bits (41), Expect = 7.4 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 Query: 249 NVCICGAKTRFDNCDIACICVHCVFKPVVS 160 N CI AK D C+I C + + S Sbjct: 113 NECIENAKGETDECNIGNKYTDCYIEKLFS 142 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 20.6 bits (41), Expect = 7.4 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 Query: 249 NVCICGAKTRFDNCDIACICVHCVFKPVVS 160 N CI AK D C+I C + + S Sbjct: 113 NECIENAKGETDECNIGNKYTDCYIEKLFS 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,699 Number of Sequences: 438 Number of extensions: 1942 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10626762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -