BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C08 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_29832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 28 5.1 SB_1307| Best HMM Match : Filament (HMM E-Value=0.13) 28 5.1 SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32) 28 6.7 SB_14968| Best HMM Match : IL3 (HMM E-Value=8.6) 28 6.7 SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 6.7 SB_24208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) 27 8.9 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 27 8.9 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 33.9 bits (74), Expect = 0.10 Identities = 32/122 (26%), Positives = 48/122 (39%), Gaps = 2/122 (1%) Frame = +2 Query: 140 TSSRVRRQAGELTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAATAGLVY- 316 T V+ + + TIN + +K + GN + L A S N K G + Y Sbjct: 658 TIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDKDVVISYS 714 Query: 317 DNVNRHGATLTNTH-IPGIGDKLSVAGKVNLFHNNDHDLSAKAFATRNMPTISHLPSTNT 493 DN+N A T+ IPG K KVN + + A + T SH ++ Sbjct: 715 DNMNNSKAANTDQFGIPGSDSKTGSDSKVNAKASGQTSNAMDASNSDTRETSSHAIGSDQ 774 Query: 494 VG 499 +G Sbjct: 775 IG 776 >SB_29832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -2 Query: 288 NLIWLVRSTEPRALSL*FSFPVIGTLTIAPEVPSELIVS 172 NL + S PR LS FP +G+ TI P S +IVS Sbjct: 1187 NLDGVDSSVMPRELSQVLRFPFLGSFTIRPLAQSSVIVS 1225 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 365 GIGDKLSVAGKVNLFHNNDHDLSAKAFAT 451 G+ D L++ G VN+FHN DL++++ +T Sbjct: 612 GLSD-LTIDGHVNIFHNQGTDLNSQSGST 639 >SB_1307| Best HMM Match : Filament (HMM E-Value=0.13) Length = 916 Score = 28.3 bits (60), Expect = 5.1 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 5/85 (5%) Frame = +2 Query: 179 INSDGTSGAMVKVPITGN-ENHKLSALGSVD----LTNQIKLGAATAGLVYDNVNRHGAT 343 I+SD + ++V +GN +N LS + S N I +T+ L + N HG+T Sbjct: 632 ISSDYHGDSSLRVHSSGNHDNTSLSGVSSGSHGNFSGNGIYRSRSTSNLSHGN---HGST 688 Query: 344 LTNTHIPGIGDKLSVAGKVNLFHNN 418 T GI L+ N FH N Sbjct: 689 TTRNMSSGIQSNLAFGRLSNGFHEN 713 >SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32) Length = 1556 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +2 Query: 401 NLFHNNDHDLSAKAFAT-RNMPTISHLPST-NTVGGGLEYMFKDKIGASASAXHTDFFNK 574 NL +D+++ T ++M + PST N GL+ + GAS S D F++ Sbjct: 513 NLTFKKAYDIASSMETTAQHMADLQSAPSTLNVELNGLKVQMELDTGASLSVIGEDIFDQ 572 Query: 575 NDYXLGGKLNL 607 G LNL Sbjct: 573 LKNIEGSSLNL 583 >SB_14968| Best HMM Match : IL3 (HMM E-Value=8.6) Length = 321 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/59 (23%), Positives = 25/59 (42%) Frame = +2 Query: 407 FHNNDHDLSAKAFATRNMPTISHLPSTNTVGGGLEYMFKDKIGASASAXHTDFFNKNDY 583 F N D++ + H P N GGG+ +FKD + ++ + FN ++ Sbjct: 224 FKNGDYNSAEMGTLCPTGYRFLHSPRLNARGGGVALLFKDLLRLEINSRICEHFNTFEF 282 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +3 Query: 402 TCFITTTMIYPRRRSRPEICPPFPIYHQPTLLVVVSNICSRTRSVHQRAP 551 TC T Y R R C PF + T V SN C TR+ + P Sbjct: 26 TCRFETC--YERDTGRATPCMPFTSFMSLTRNVTTSNTCGTTRAKYCELP 73 >SB_24208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.5 bits (58), Expect = 8.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 476 NGKWWAYFWSRTPSRINH 423 N +WW Y + RTP H Sbjct: 13 NSEWWMYLYHRTPEGATH 30 >SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) Length = 733 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 488 WLMVNGKWWAYFWSRTPSRINHG 420 WL+ N W FW+ P +HG Sbjct: 165 WLLSNTNWMRKFWTSDPKFRSHG 187 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 279 WLVRSTEPRALSL*FSFPVIGTLTIAPEVPSELIV 175 W+V ++EP LS +I T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,482,472 Number of Sequences: 59808 Number of extensions: 374981 Number of successful extensions: 903 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -