BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C07 (401 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14096.1 68417.m02176 F-box family protein contains F-box dom... 28 2.7 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 27 3.5 >At4g14096.1 68417.m02176 F-box family protein contains F-box domain Pfam:PF00646 Length = 468 Score = 27.9 bits (59), Expect = 2.7 Identities = 18/80 (22%), Positives = 36/80 (45%) Frame = -1 Query: 302 SQKGLHYFKLKLQLIYPSALASPKTAIAGPALIMPFLMLRPIFSIFLKTFHFGSGAAETV 123 S LH + ++ + ++PS + KT + ++ P L ++ LKT + S E Sbjct: 115 SDLDLHVY-METEFVFPSEMFLSKTLVRLKLMLYPLLEFEDVYLPKLKTLYIDSCYFEKY 173 Query: 122 DKARTRANTKKNILEKFIVE 63 T+ + ILE +++ Sbjct: 174 GIGLTKLLSGCPILEDLVLD 193 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 157 LSISAQAQPKLSTKPEPERTRRKISLRSSSLNIVNFNK 44 +S++A+ PKLS+ E ER R + + I+N N+ Sbjct: 789 MSLAARFPPKLSSSREDERNVRSVVVEDPEGCILNLNE 826 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,765,241 Number of Sequences: 28952 Number of extensions: 92260 Number of successful extensions: 313 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -