BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C05 (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 3.4 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 6.0 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 273 WANGRWTMSSVPRISPTRRTHQLSLNSSTSMMIPQDTKL 389 + NG W ++ ++SP S N + S+ P DT L Sbjct: 475 FTNG-WANGTLAKLSPKVLEPLYSGNLAVSVATPNDTSL 512 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 161 RYDFGLGKRAYSYVSEYKR 217 +Y FGL + YS+ E K+ Sbjct: 279 QYPFGLPEYEYSFYQEVKK 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,939 Number of Sequences: 336 Number of extensions: 2307 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -