BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C05 (597 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81525-2|CAB04255.2| 99|Caenorhabditis elegans Hypothetical pr... 39 0.002 Z68315-6|CAA92671.1| 219|Caenorhabditis elegans Hypothetical pr... 29 2.5 U00045-3|AAL02502.1| 868|Caenorhabditis elegans Temporarily ass... 29 3.3 AF026205-2|AAB71255.3| 86|Caenorhabditis elegans Neuropeptide-... 29 3.3 U29377-10|AAA68717.1| 140|Caenorhabditis elegans Hypothetical p... 28 4.4 AL110477-20|CAB76740.3| 728|Caenorhabditis elegans Hypothetical... 28 4.4 AF039050-7|ABC71842.1| 516|Caenorhabditis elegans Cytochrome p4... 27 7.7 AF039050-6|AAC47939.2| 499|Caenorhabditis elegans Cytochrome p4... 27 7.7 AF039050-4|AAC47937.1| 499|Caenorhabditis elegans Cytochrome p4... 27 7.7 >Z81525-2|CAB04255.2| 99|Caenorhabditis elegans Hypothetical protein F33A8.2 protein. Length = 99 Score = 39.1 bits (87), Expect = 0.002 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 386 VKRARPY-SFGLGKRIADEDLSE-EKRARMYDFGLGKRLPMYNFGLGKRAYSYNFGLGKR 559 V + PY +F KR +E+L EKRAR +G KR P F KRA Y F KR Sbjct: 36 VDKRSPYRAFAFAKRSDEENLDFLEKRAR---YGFAKRSPYRTFAFAKRASPYGFAFAKR 92 >Z68315-6|CAA92671.1| 219|Caenorhabditis elegans Hypothetical protein F28C6.5 protein. Length = 219 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 553 PESEVVAVGALAETEVVHGKPLAQPEVVHPSAL 455 PE + V L E E +HG+PL PE++ PS L Sbjct: 84 PEPQDVVAVPLDE-EALHGEPLFPPELILPSEL 115 >U00045-3|AAL02502.1| 868|Caenorhabditis elegans Temporarily assigned gene nameprotein 204, isoform b protein. Length = 868 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 275 GKRSVDDELGAEDLPNETDPPALSELFDE 361 G+R+ D E+ +P+ + P + ELFDE Sbjct: 41 GQRAADVEMMTSSVPSSSQPSSFVELFDE 69 >AF026205-2|AAB71255.3| 86|Caenorhabditis elegans Neuropeptide-like protein protein 6 protein. Length = 86 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 10/57 (17%) Frame = +2 Query: 170 FGLGKRAYSYVSEY------KRLPVYNF--GLGKRS--RPYSFGLGKRSVDDELGAE 310 FG GKR+ + +S+ KR +F G GKR+ R ++ G GKRS + ++ + Sbjct: 28 FGFGKRSMADISDMPEDVPMKRYKPRSFAMGFGKRAAMRSFNMGFGKRSAEPQIDVD 84 >U29377-10|AAA68717.1| 140|Caenorhabditis elegans Hypothetical protein K05F1.10 protein. Length = 140 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/68 (22%), Positives = 27/68 (39%) Frame = -2 Query: 380 ILRYHHTRRRVQRELVGPSRWGDPRHRAHRPPTVCPDRTSKDVIVSQGRSYKREVFCIQR 201 + +HH +RR+ PRHR P T + + + ++ + C Sbjct: 17 LFHHHHNKRRIL-----------PRHRVRSPATRTRIHVRSERKAEECQKHEHHLICGPE 65 Query: 200 RNCRRACQ 177 R+C R C+ Sbjct: 66 RHCDRTCE 73 >AL110477-20|CAB76740.3| 728|Caenorhabditis elegans Hypothetical protein Y113G7B.18 protein. Length = 728 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 379 SCGIIILVEEFRESWWVRLVGEILGTELIVH 287 +CG + + E RE W VR VG+ + +L H Sbjct: 273 NCGFLRELREMREIWRVRKVGDYICGDLSYH 303 >AF039050-7|ABC71842.1| 516|Caenorhabditis elegans Cytochrome p450 family protein34A9, isoform b protein. Length = 516 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 407 SFGLGKRIADEDLSEEKRARMYDF 478 +FGLG+ I ++ + EE R R DF Sbjct: 134 NFGLGRNIMEDKIMEEYRYRFKDF 157 >AF039050-6|AAC47939.2| 499|Caenorhabditis elegans Cytochrome p450 family protein34A9, isoform a protein. Length = 499 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 407 SFGLGKRIADEDLSEEKRARMYDF 478 +FGLG+ I ++ + EE R R DF Sbjct: 134 NFGLGRNIMEDKIMEEYRYRFKDF 157 >AF039050-4|AAC47937.1| 499|Caenorhabditis elegans Cytochrome p450 family protein 34A7 protein. Length = 499 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 407 SFGLGKRIADEDLSEEKRARMYDF 478 +FGLG+ I ++ + EE R R DF Sbjct: 134 NFGLGRNIIEDKIMEEYRYRFEDF 157 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,904,285 Number of Sequences: 27780 Number of extensions: 237790 Number of successful extensions: 896 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -