BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C05 (597 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 25 0.56 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 1.3 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 6.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.2 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.2 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 25.0 bits (52), Expect = 0.56 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 386 LRILRYHHTRRRVQR--ELVGPSRWGDPRHRAHRPPTVCPDRTSKDVIVSQGRSYKREVF 213 +R+LR R V + E+ P RH R PDRTSKD QG + EVF Sbjct: 217 VRLLRLSRLVRYVSQWEEVYIPLYQQPERHYERRATPPQPDRTSKD----QGTIGESEVF 272 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.8 bits (49), Expect = 1.3 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 321 TRRTHQLSLNSSTSMMIPQDTKLSALDPTASDWA--SASQTKIYLKRSAL 464 T+R NS+ + I +D KLS D A+ A SAS T + + S L Sbjct: 154 TKRDVIYKWNSARQVAIAEDMKLSQFDLVANPTANYSASTTLSHAEYSML 203 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 488 CPTRSRTSERASLQINL 438 CPT T+ RAS+ I L Sbjct: 270 CPTNLGTTVRASVHIKL 286 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +2 Query: 86 ERVPHEHDRGEHEPDEHSALEKRSPRY 166 ++ P+ HD + +P E L K + Y Sbjct: 461 QQFPYVHDTLQIQPQEQLTLSKVTSNY 487 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 269 GLGKRSVDDELGAEDLPNETDP 334 GLG + G DLP ET P Sbjct: 277 GLGHYGHHPDPGEVDLPPETQP 298 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,288 Number of Sequences: 438 Number of extensions: 3091 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -