BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C04 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_29957| Best HMM Match : Pro_racemase (HMM E-Value=0) 29 2.6 >SB_55084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 326 YLCDVAMFVICSDNTTRSVINHASSTGNSVAMSDGLEFCS 207 Y + ++ CS N+T V N A + NS + + FCS Sbjct: 21 YFSNASLAAFCSTNSTSGVSNIAFCSANSTSGVSNMAFCS 60 >SB_29957| Best HMM Match : Pro_racemase (HMM E-Value=0) Length = 576 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 275 SVINHASSTGNSVAMSDGLEFCSKRYHIID 186 ++I++ S TGN + + GL +C K Y++ D Sbjct: 94 NMISNLSHTGNPIQLPYGLAWCGKYYNMCD 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,436,112 Number of Sequences: 59808 Number of extensions: 369182 Number of successful extensions: 718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -