BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C03 (515 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0178 + 6195402-6199158,6199438-6200003 29 2.9 04_03_0118 - 11474060-11475298 28 3.9 01_07_0232 + 42182942-42183490,42183593-42183661,42184320-421844... 28 5.1 06_01_0416 + 2965761-2965809,2965995-2966172,2966256-2966327,296... 27 6.8 03_03_0146 - 14835236-14835445,14835525-14835714,14836740-14837269 27 6.8 06_03_1220 - 28505306-28508497 27 8.9 02_02_0726 - 13374061-13374151,13374576-13374787,13374990-133750... 27 8.9 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 410 VCLILWHASCGSRRYLVHHS*GVARRYHRG-LRSKCRRSCHPDELPG 273 VCL H CG R L+ +R Y L+ C HP E+ G Sbjct: 1137 VCLHWCHTDCGLRHSLIRKGGSGSRAYSTNELQFHCAACGHPSEMFG 1183 >04_03_0118 - 11474060-11475298 Length = 412 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 338 RRYHRGLRSKCRRSCHPDE 282 R+YH R C SC+PDE Sbjct: 304 RKYHAIFRKHCTPSCYPDE 322 >01_07_0232 + 42182942-42183490,42183593-42183661,42184320-42184451, 42184547-42184600,42184714-42184758,42185383-42185522, 42185777-42185902,42185985-42186002,42186631-42187276, 42188121-42188843 Length = 833 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 333 VSSGLTVQVPTILSP*RASRRMPAILSSGVLPL 235 VSS + +P + SP +ASRR+ A+ S LPL Sbjct: 19 VSSQPPLHLPRLRSPHQASRRLSALPFSRALPL 51 >06_01_0416 + 2965761-2965809,2965995-2966172,2966256-2966327, 2966849-2967137,2967941-2968081,2969011-2969115, 2969354-2969501,2970023-2970075,2970189-2970266, 2970361-2970480,2970779-2970943,2971663-2971797, 2972063-2972182 Length = 550 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 144 VPWDHVEARARRCSGGVSAGKRHHRCNCYYVSE 46 VPW + ARR + G+ + HR N Y V + Sbjct: 186 VPWMREDLFARRDARGIDKVRSSHRVNAYDVED 218 >03_03_0146 - 14835236-14835445,14835525-14835714,14836740-14837269 Length = 309 Score = 27.5 bits (58), Expect = 6.8 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 376 HGVIWFTTVEGLREGIIGAYGPSADDL-VTLTSFQE--DAGHFVFG 248 H +W +E + E +G G ADD+ L S E D+G+ FG Sbjct: 142 HAALWVKEIEKMEEARLGGGGGGADDIDRLLDSCSEIFDSGNTDFG 187 >06_03_1220 - 28505306-28508497 Length = 1063 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 281 ARQGDKIVGTWTVSPDDTFSQPLNCG 358 +R GD IVG W SPD + CG Sbjct: 43 SRAGDGIVGEWQRSPDCCTWDGVGCG 68 >02_02_0726 - 13374061-13374151,13374576-13374787,13374990-13375002, 13375318-13375655 Length = 217 Score = 27.1 bits (57), Expect = 8.9 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -3 Query: 96 VSAGKRHHRCNCYYVSEHHL 37 +S K+H +C+ ++VSE H+ Sbjct: 39 ISNAKKHEQCDLFHVSESHI 58 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,882,536 Number of Sequences: 37544 Number of extensions: 401124 Number of successful extensions: 1043 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -