BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C03 (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 26 0.87 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 24 3.5 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 6.1 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 6.1 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 8.1 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 25.8 bits (54), Expect = 0.87 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 264 PASSWKLVRVTRSSALGP*APMIPSRNPSTVV 359 PAS W+ VR+ R P ++ SR ST V Sbjct: 396 PASFWQFVRIRRGCNTLPNEMVLDSRTASTPV 427 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 162 CLNISSVPWDHVEARARRCSGGV 94 C+NIS VP++ ++R S GV Sbjct: 174 CVNISDVPFNRTLLSSQRESAGV 196 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 391 MHLVGHGVIWFTTVEGLREGIIGAYGPSADDLVTLTS 281 ++ H V W G R GI+G + LVT S Sbjct: 457 LYQADHPVHWSPVFMGGRSGILGRESENRRKLVTTVS 493 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 205 KSWSFH*RGYQRQNTRRQNGRHPPGSSSG*QDRRHLDRKP 324 K W + R ++N++RQ+ + GSS+ H +P Sbjct: 315 KIWFQNRRMKNKKNSQRQSAQANSGSSNNSSSHSHSQAQP 354 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 161 QYQRPYTITTAVSSVKAGHSIDVV 232 QY++ + TT V +A S+DVV Sbjct: 272 QYKQEHNTTTKVLMTEAWSSLDVV 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,496 Number of Sequences: 2352 Number of extensions: 13549 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -