BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C02 (526 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.13c |tfg2|SPBC660.03c|transcription factor TFIIF comple... 27 1.7 SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyce... 26 4.0 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 25 5.2 SPAC1F8.05 |isp3|meu4|sequence orphan|Schizosaccharomyces pombe|... 25 5.2 SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos... 25 6.9 >SPBC1198.13c |tfg2|SPBC660.03c|transcription factor TFIIF complex beta subunit Tfg2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 307 Score = 27.1 bits (57), Expect = 1.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 385 DPVLITNKRDELALKLELKTDYAG 456 D + I NKR ALK LK +Y G Sbjct: 231 DSIAILNKRGPYALKYSLKPEYKG 254 >SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1151 Score = 25.8 bits (54), Expect = 4.0 Identities = 15/63 (23%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +1 Query: 76 SLTPLCNNTAVSITSNDSPPFNNADPVMQLYNSVIVSD--YKAAVKTTFQLEKECRSDVI 249 +LTP + A S + +PP +N + + + +++ +K+ V+T E +S+ Sbjct: 205 TLTPYAEDYAFSSLNTSAPPLSNKEYAFSVNHLPAINEHKWKSRVETNMLFELRIKSNDN 264 Query: 250 SSV 258 SV Sbjct: 265 QSV 267 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 55 SALVTRVSLTPLCNNTAVSITSNDSPPFNNA 147 S T S TPL + + + TS S PF N+ Sbjct: 544 STTATSASSTPLTSVNSTTATSASSTPFGNS 574 Score = 24.6 bits (51), Expect = 9.1 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 161 SYTIASSSVTTRLLLKLPFN*KRNAEVTSSAPS*INYSSKDNQTSSNTLTVS 316 S ++ASSS T+ L N +A TSSA S SS + +SN+ T S Sbjct: 146 SSSLASSSTTSSSLASSSTNSTTSATPTSSATS----SSLSSTAASNSATSS 193 Score = 24.6 bits (51), Expect = 9.1 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +1 Query: 52 LSALVTRVSLTPLCNNTAVSITSNDSPPFNNADPVMQLYNSVIVSDYKAAVKTTF 216 +S VT + TPL N+T ++ S FN + S +S+ A +TF Sbjct: 597 VSGSVTTPTSTPLSNSTVAPTSTFTSSGFNTTSGLPTSSASTPLSNSTVAPTSTF 651 >SPAC1F8.05 |isp3|meu4|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 182 Score = 25.4 bits (53), Expect = 5.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 244 VISSVVNKLLLEGQPNVVEYAYSLWY 321 V+ NK+ ++G+PNV + WY Sbjct: 22 VLIDAFNKVTIDGKPNVQHQQPTYWY 47 >SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual Length = 640 Score = 25.0 bits (52), Expect = 6.9 Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Frame = +1 Query: 52 LSALVTRVSLTPLCNNTAVSITSN------DSPPFNNADPVMQLYNSVIVSDYKAAVKTT 213 L ++VSL+P+ + + S+T++ S P + P M+ +S + S ++ + Sbjct: 293 LHTSASQVSLSPMASTASSSVTNSPVDTHTPSTPIMSRPPSMKALSSGVESQDESVASSN 352 Query: 214 FQL 222 FQ+ Sbjct: 353 FQV 355 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,805,753 Number of Sequences: 5004 Number of extensions: 32174 Number of successful extensions: 112 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 214353836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -