BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_C02 (526 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0606 + 18909065-18909218,18909674-18909737,18910895-189110... 30 1.3 09_06_0311 + 22218219-22218421,22219157-22219422,22219881-222200... 27 7.0 05_05_0195 + 23142830-23143714,23144288-23144314,23144657-231448... 27 9.2 05_04_0327 + 20298659-20298724,20300119-20300332,20300556-203006... 27 9.2 >09_04_0606 + 18909065-18909218,18909674-18909737,18910895-18911023, 18913680-18913830,18914369-18914491,18915638-18915711, 18916048-18916591,18916948-18917085,18917159-18917203 Length = 473 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 151 PVMQLYNSVIVSDYKAAVKTTFQLEKECRSDVISSVV 261 P + L N +I+SD A + + E + DVI+SV+ Sbjct: 252 PALDLINILIISDASALISFKMKYESFTKGDVINSVI 288 >09_06_0311 + 22218219-22218421,22219157-22219422,22219881-22220050, 22220149-22220365,22220798-22221021,22221559-22221738, 22221875-22222013,22222107-22222255,22223394-22223505, 22223998-22224506,22224661-22224784,22224904-22225178, 22225507-22225626,22225707-22225769,22225861-22226052, 22226381-22226440,22226535-22226738,22226926-22227051, 22227093-22227254,22227357-22227476,22227665-22227820, 22227895-22227957,22228041-22228168,22228524-22228920, 22229442-22229544,22229646-22229776,22230096-22230167, 22230472-22230553,22231083-22231190,22231288-22231429, 22231659-22231698,22231746-22231876,22232215-22232301, 22232395-22232605,22232687-22232741,22232836-22232927, 22233011-22233071,22233361-22233719 Length = 2010 Score = 27.5 bits (58), Expect = 7.0 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = +1 Query: 70 RVSLTPLCNNTAVSITSN-DSPPFNNADPVMQLYNSVIVSDYKAAVKTTFQLEKECRSDV 246 +++LTP CN++ ++I N D F NA ++ + V + + ++Q+E R Sbjct: 1822 KLNLTPSCNHSIITIGGNTDVELFWNAKDLLSA-SRVDTNGRGVPSQISYQVEALKRQSF 1880 Query: 247 ISSVVNKLLLEGQPNVVEYAY 309 + L GQ +E Y Sbjct: 1881 YDKITIILPATGQTEEIEVIY 1901 >05_05_0195 + 23142830-23143714,23144288-23144314,23144657-23144866, 23144976-23145242,23146290-23146376,23146495-23146553, 23147166-23147768,23148063-23148192,23148570-23149100, 23149636-23149743,23149911-23150456,23150957-23151079, 23151494-23151709 Length = 1263 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = -2 Query: 384 FVKQQSKLYRKVNFDYVLTGSVPETVSVFDDVWLSFEE*FIYDGADDVTSAFLF*LKGSF 205 + +++ + + ++ DYVLT ++ +V F VWL + ADD + L +KG Sbjct: 1001 YERRKGRFFEEI--DYVLTDTIRGSVVDFFTVWLPAPTISVLSYADDGSGESLEFVKGLL 1058 Query: 204 NS 199 S Sbjct: 1059 GS 1060 >05_04_0327 + 20298659-20298724,20300119-20300332,20300556-20300632, 20301067-20301177,20301283-20301444 Length = 209 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +1 Query: 241 DVISSVVNKLLLEGQPNVVEYAYSLWYRSGEDIVKVYFPIEFRLLFNEDPVLITNKRDEL 420 D+IS + KL G E A +W G K +L + +L + RDE Sbjct: 31 DIISDELQKLKQHGDGKAEEEADMIWEYQGPQTAKPVETESEDILLEMERLLYEDMRDE- 89 Query: 421 ALKLELK 441 A+++E++ Sbjct: 90 AIQIEVE 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,509,757 Number of Sequences: 37544 Number of extensions: 196128 Number of successful extensions: 518 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -